Recombinant Bovine Ubiquitin carboxyl-terminal hydrolase 14(USP14)

Product Type Recombinant Protein
Uniprot No. Q0IIF7
Abbreviation USP14
Species Bos taurus (Bovine)
Gene Names USP14
Protein Names Recommended name: Ubiquitin carboxyl-terminal hydrolase 14 EC= 3.4.19.12 Alternative name(s): Deubiquitinating enzyme 14 Ubiquitin thioesterase 14 Ubiquitin-specific-processing protease 14
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
HGNC 12612
RGD 1311825
MGI 1928898
Function Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Plays a role in the innate immune defense against viruses by stabilizing the viral DNA sensor CGAS and thus inhibiting its autophagic degradation.
Subcellular Location Cytoplasm, Cell membrane, Peripheral membrane protein
Protein Families Peptidase C19 family, USP14/UBP6 subfamily
Database Links

KEGG: bta:505106

STRING: 9913.ENSBTAP00000025580

UniGene: Bt.20599

Product Details for Different Expression Systems

Product Name Recombinant Bovine Ubiquitin carboxyl-terminal hydrolase 14(USP14),Yeast
Code CSB-YP603794BO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence PLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNI KMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQ CIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHM AFPQFAEKGEQGQYLQQDANECWVQMMRVLQQKLEAIEDDTVKETDSSSASAVTPSKKKS LIDQFFGVEFETTMKCTESEEEEVTKGKESQLQLSCFINQEVKYLFTGLKLRLQEEITKQ SPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTP ELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSSPQKEVKYEPFSFADDIGSNNCGYYDLQ AVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYG PRRVEIMEEESEQ
Expression Region 2-494
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine Ubiquitin carboxyl-terminal hydrolase 14(USP14),E.coli
Code CSB-EP603794BO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence PLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNI KMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQ CIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHM AFPQFAEKGEQGQYLQQDANECWVQMMRVLQQKLEAIEDDTVKETDSSSASAVTPSKKKS LIDQFFGVEFETTMKCTESEEEEVTKGKESQLQLSCFINQEVKYLFTGLKLRLQEEITKQ SPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTP ELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSSPQKEVKYEPFSFADDIGSNNCGYYDLQ AVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYG PRRVEIMEEESEQ
Expression Region 2-494
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine Ubiquitin carboxyl-terminal hydrolase 14(USP14),Baculovirus
Code CSB-BP603794BO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence PLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNI KMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQ CIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHM AFPQFAEKGEQGQYLQQDANECWVQMMRVLQQKLEAIEDDTVKETDSSSASAVTPSKKKS LIDQFFGVEFETTMKCTESEEEEVTKGKESQLQLSCFINQEVKYLFTGLKLRLQEEITKQ SPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTP ELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSSPQKEVKYEPFSFADDIGSNNCGYYDLQ AVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYG PRRVEIMEEESEQ
Expression Region 2-494
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine Ubiquitin carboxyl-terminal hydrolase 14(USP14),Mammalian cell
Code CSB-MP603794BO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence PLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNI KMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQ CIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHM AFPQFAEKGEQGQYLQQDANECWVQMMRVLQQKLEAIEDDTVKETDSSSASAVTPSKKKS LIDQFFGVEFETTMKCTESEEEEVTKGKESQLQLSCFINQEVKYLFTGLKLRLQEEITKQ SPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTP ELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSSPQKEVKYEPFSFADDIGSNNCGYYDLQ AVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYG PRRVEIMEEESEQ
Expression Region 2-494
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.