Recombinant Bovine V-type proton ATPase subunit G 1(ATP6V1G1)

Product Type Recombinant Protein
Uniprot No. P79251
Species Bos taurus (Bovine)
Gene Names ATP6V1G1
Protein Names Recommended name: V-type proton ATPase subunit G 1 Short name= V-ATPase subunit G 1 Alternative name(s): V-ATPase 13 kDa subunit 1 Vacuolar proton pump subunit G 1 Vacuolar proton pump subunit M16
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This protein is one of three V1 domain G subunit proteins. Pseudogenes of this gene have been characterized.
Function Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (By similarity).
Protein Families V-ATPase G subunit family
Tissue Specificity Brain, heart, kidney and spleen.
Database Links

KEGG: bta:281641

STRING: 9913.ENSBTAP00000000240

UniGene: Bt.1990

Pathway mTOR signaling pathway
Oxidative Phosphorylation
Synaptic vesicle cycle

Product Details for Different Expression Systems

Product Name Recombinant Bovine V-type proton ATPase subunit G 1(ATP6V1G1),Yeast
Code CSB-YP002408BO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence ASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEVEQYRLQREKEFKAKEAA ALGSHGSCSTEVEKDTQEKMTILQTYFQQNRDEVLDNLLAFVCDIRPEIHENYRING
Expression Region 2-118
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine V-type proton ATPase subunit G 1(ATP6V1G1),E.coli
Code CSB-EP002408BO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence ASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEVEQYRLQREKEFKAKEAA ALGSHGSCSTEVEKDTQEKMTILQTYFQQNRDEVLDNLLAFVCDIRPEIHENYRING
Expression Region 2-118
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine V-type proton ATPase subunit G 1(ATP6V1G1),Baculovirus
Code CSB-BP002408BO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence ASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEVEQYRLQREKEFKAKEAA ALGSHGSCSTEVEKDTQEKMTILQTYFQQNRDEVLDNLLAFVCDIRPEIHENYRING
Expression Region 2-118
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine V-type proton ATPase subunit G 1(ATP6V1G1),Mammalian cell
Code CSB-MP002408BO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence ASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEVEQYRLQREKEFKAKEAA ALGSHGSCSTEVEKDTQEKMTILQTYFQQNRDEVLDNLLAFVCDIRPEIHENYRING
Expression Region 2-118
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.