Recombinant Burkholderia vietnamiensis 3-demethylubiquinone-9 3-methyltransferase(ubiG)

Product Type Recombinant Protein
Uniprot No. A4JCG7
Species Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))
Gene Names ubiG
Protein Names Recommended name: 3-demethylubiquinone-9 3-methyltransferase EC= 2.1.1.64 Alternative name(s): 2-polyprenyl-6-hydroxyphenyl methylase EC= 2.1.1.222 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase Short name= DHHB meth
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function O-methyltransferase that catalyzes the 2 O-methylation steps in the ubiquinone biosynthetic pathway.
Protein Families Methyltransferase superfamily, UbiG/COQ3 family
Database Links

KEGG: bvi:Bcep1808_0959

STRING: 269482.Bcep1808_0959

Product Details for Different Expression Systems

Product Name Recombinant Burkholderia vietnamiensis 3-demethylubiquinone-9 3-methyltransferase(ubiG),Yeast
Code CSB-YP393143BPV
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTNADPHELQKFSDLAHRWWDPNAEFKPLHDLNPVRLGWIDSHAHLAGKRALDIGCGGGI LSESMAGLGAQVKGIDLSNEALGVADLHSLESGITVDYEAIAAEAIAEREPGSYDVVTCM EMLEHVPSPAGVVSACAKLVKPGGWVFFSTLNRNLKSYLFAVIGAEYIAQMLPKGTHDYA RFIRPSELAGFVRATDLHIVELKGITYHPIGKRFALSNDTDINYLVACRRGA
Expression Region 1-232
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Burkholderia vietnamiensis 3-demethylubiquinone-9 3-methyltransferase(ubiG),E.coli
Code CSB-EP393143BPV
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTNADPHELQKFSDLAHRWWDPNAEFKPLHDLNPVRLGWIDSHAHLAGKRALDIGCGGGI LSESMAGLGAQVKGIDLSNEALGVADLHSLESGITVDYEAIAAEAIAEREPGSYDVVTCM EMLEHVPSPAGVVSACAKLVKPGGWVFFSTLNRNLKSYLFAVIGAEYIAQMLPKGTHDYA RFIRPSELAGFVRATDLHIVELKGITYHPIGKRFALSNDTDINYLVACRRGA
Expression Region 1-232
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Burkholderia vietnamiensis 3-demethylubiquinone-9 3-methyltransferase(ubiG),Baculovirus
Code CSB-BP393143BPV
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTNADPHELQKFSDLAHRWWDPNAEFKPLHDLNPVRLGWIDSHAHLAGKRALDIGCGGGI LSESMAGLGAQVKGIDLSNEALGVADLHSLESGITVDYEAIAAEAIAEREPGSYDVVTCM EMLEHVPSPAGVVSACAKLVKPGGWVFFSTLNRNLKSYLFAVIGAEYIAQMLPKGTHDYA RFIRPSELAGFVRATDLHIVELKGITYHPIGKRFALSNDTDINYLVACRRGA
Expression Region 1-232
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Burkholderia vietnamiensis 3-demethylubiquinone-9 3-methyltransferase(ubiG),Mammalian cell
Code CSB-MP393143BPV
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTNADPHELQKFSDLAHRWWDPNAEFKPLHDLNPVRLGWIDSHAHLAGKRALDIGCGGGI LSESMAGLGAQVKGIDLSNEALGVADLHSLESGITVDYEAIAAEAIAEREPGSYDVVTCM EMLEHVPSPAGVVSACAKLVKPGGWVFFSTLNRNLKSYLFAVIGAEYIAQMLPKGTHDYA RFIRPSELAGFVRATDLHIVELKGITYHPIGKRFALSNDTDINYLVACRRGA
Expression Region 1-232
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.