Recombinant Calloselasma rhodostoma Zinc metalloproteinase/disintegrin,partial

Product Type Recombinant Protein
Uniprot No. P30403
Species Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
Protein Names Recommended name: Zinc metalloproteinase/disintegrinCleaved into the following 2 chains: 1. Metalloproteinase rhodostoxin EC= 2. 3.4.24.-Alternative name(s): Hemorrhagic protein Disintegrin rhodostomin Short name= RHOAlter
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Snake venom metalloproteinase rhodostoxin
Subcellular Location Secreted
Protein Families Venom metalloproteinase (M12B) family, P-II subfamily, P-IIa sub-subfamily
Tissue Specificity Expressed by the venom gland.

Product Details for Different Expression Systems

Product Name Recombinant Calloselasma rhodostoma Zinc metalloproteinase/disintegrin,partial,Yeast
Code CSB-YP341149CBG
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence NH EIKRHVDIVV VVDSRFCTKH SNDLEVIRKF VHEVVNAIIE SYKYMHFGIS LVNLETWCNG DLINVQEDSY ETLKAFGKWR ESDLIKHVNH SNAQFLMDMK FIKNIIGKAY LDSICDPERS VGIVQNYHGI TLNVAAIMAH EMGHNLGVRH DGEYCTCYGS SECIMSSHIS DPPSKYFSNC SYYQFWKYIE NQNPQCILNK P
Expression Region 189-391
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Calloselasma rhodostoma Zinc metalloproteinase/disintegrin,partial,E.coli
Code CSB-EP341149CBG
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence NH EIKRHVDIVV VVDSRFCTKH SNDLEVIRKF VHEVVNAIIE SYKYMHFGIS LVNLETWCNG DLINVQEDSY ETLKAFGKWR ESDLIKHVNH SNAQFLMDMK FIKNIIGKAY LDSICDPERS VGIVQNYHGI TLNVAAIMAH EMGHNLGVRH DGEYCTCYGS SECIMSSHIS DPPSKYFSNC SYYQFWKYIE NQNPQCILNK P
Expression Region 189-391
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Calloselasma rhodostoma Zinc metalloproteinase/disintegrin,partial,Baculovirus
Code CSB-BP341149CBG
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence NH EIKRHVDIVV VVDSRFCTKH SNDLEVIRKF VHEVVNAIIE SYKYMHFGIS LVNLETWCNG DLINVQEDSY ETLKAFGKWR ESDLIKHVNH SNAQFLMDMK FIKNIIGKAY LDSICDPERS VGIVQNYHGI TLNVAAIMAH EMGHNLGVRH DGEYCTCYGS SECIMSSHIS DPPSKYFSNC SYYQFWKYIE NQNPQCILNK P
Expression Region 189-391
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Calloselasma rhodostoma Zinc metalloproteinase/disintegrin,partial,Mammalian cell
Code CSB-MP341149CBG
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence NH EIKRHVDIVV VVDSRFCTKH SNDLEVIRKF VHEVVNAIIE SYKYMHFGIS LVNLETWCNG DLINVQEDSY ETLKAFGKWR ESDLIKHVNH SNAQFLMDMK FIKNIIGKAY LDSICDPERS VGIVQNYHGI TLNVAAIMAH EMGHNLGVRH DGEYCTCYGS SECIMSSHIS DPPSKYFSNC SYYQFWKYIE NQNPQCILNK P
Expression Region 189-391
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

Q&A
Q:

We are looking for a source of Disintegrin rhodostomin which appears to be one chain (aa 408–475) of Zinc metalloproteinase/disintegrin.
https://www.uniprot.org/uniprot/P30403#PRO_0000028959
I can only find a recombinant corresponding to the other chain Snake venom metalloproteinase rhodostoxin (aa 189–391)
CSB-EP341149CBG; CSB-YP341149CBG; CSB-BP341149CBG; CSB-MP341149CBG Recombinant Calloselasma rhodostoma Zinc metalloproteinase/disintegrin (RHOD)

Do you have anything corresponding to the Disintegrin rhodostomin chain?

A:
Thanks for your inquiry.
Although we only list the protein corresponding to the other chain Snake venom metalloproteinase rhodostoxin (aa 189-391), please feel free to check with us if you can't find the desired product on our website.
We can provide the protein corresponding to the chain (aa 408-475) of Zinc metalloproteinase/disintegrin.
https://www.uniprot.org/uniprot/P30403
Recombinant Calloselasma rhodostoma Zinc metalloproteinase/disintegrin,partial
CSB-YP341149CBG >> Yeast
CSB-EP341149CBG >> E.coli
CSB-BP341149CBG >> Baculovirus
CSB-MP341149CBG >> Mammalian cell
Expression Region: 189-391aa; Partial, provide the Snake venom metalloproteinase rhodostoxin chain
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

NHEIKRHVDIVVVVDSRFCTKHSNDLEVIRKFVHEVVNAIIESYKYMHFGISLVNLETWCNGDLINVQEDSYETLKAFGKWRESDLIKHVNHSNAQFLMDMKFIKNIIGKAYLDSICDPERSVGIVQNYHGITLNVAAIMAHEMGHNLGVRHDGEYCTCYGSSECIMSSHISDPPSKYFSNCSYYQFWKYIENQNPQCILNKP


Recombinant Calloselasma rhodostoma Zinc metalloproteinase/disintegrin,partial
CSB-YP341149CBG1 >> Yeast
CSB-EP341149CBG1 >> E.coli
CSB-BP341149CBG1 >> Baculovirus
CSB-MP341149CBG1 >> Mammalian cell
Expression Region: 408-475aa; Partial, provide the Disintegrin rhodostomin chain
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGDMPDDRCTGQSADCPRYH

Customer Reviews

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.