Code | CSB-YP341149CBG |
MSDS | |
Size | Pls inquire |
Source | Yeast |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP341149CBG |
MSDS | |
Size | Pls inquire |
Source | E.coli |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP341149CBG-B |
MSDS | |
Size | Pls inquire |
Source | E.coli |
Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-BP341149CBG |
MSDS | |
Size | Pls inquire |
Source | Baculovirus |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-MP341149CBG |
MSDS | |
Size | Pls inquire |
Source | Mammalian cell |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
We are looking for a source of Disintegrin rhodostomin which appears to be one chain (aa 408–475) of Zinc metalloproteinase/disintegrin.
https://www.uniprot.org/uniprot/P30403#PRO_0000028959
I can only find a recombinant corresponding to the other chain Snake venom metalloproteinase rhodostoxin (aa 189–391)
CSB-EP341149CBG; CSB-YP341149CBG; CSB-BP341149CBG; CSB-MP341149CBG Recombinant Calloselasma rhodostoma Zinc metalloproteinase/disintegrin (RHOD)
Do you have anything corresponding to the Disintegrin rhodostomin chain?
NHEIKRHVDIVVVVDSRFCTKHSNDLEVIRKFVHEVVNAIIESYKYMHFGISLVNLETWCNGDLINVQEDSYETLKAFGKWRESDLIKHVNHSNAQFLMDMKFIKNIIGKAYLDSICDPERSVGIVQNYHGITLNVAAIMAHEMGHNLGVRHDGEYCTCYGSSECIMSSHISDPPSKYFSNCSYYQFWKYIENQNPQCILNKP
GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGDMPDDRCTGQSADCPRYH