Recombinant Gloydius blomhoffii Disintegrin halysin,Yeast

Code CSB-YP322037GGN
Product Type Recombinant Protein
Size US$2959
Uniprot No. P21858
Relevance Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Platelet aggregation activation inhibitor
Species Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF
Research Area Others
Source Yeast
Protein Names Recommended name: Disintegrin halysin Alternative name(s): Platelet aggregation activation inhibitor
Expression Region 1-71aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 9.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
Subcellular Location Secreted
Protein Families Venom metalloproteinase (M12B) family, P-II subfamily, P-IIa sub-subfamily
Tissue Specificity Expressed by the venom gland.

Related Products

Proteins

Proteins for Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.