Recombinant Human Antileukoproteinase(SLPI)

Code CSB-EP021781HU
Size US$2062Purchase it in Cusabio online store
(only available for customers from the US)
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names SLPI
Uniprot No. P03973
Research Area Cardiovascular
Alternative Names ALK 1; ALK1; ALP; Antileukoprotease; Antileukoproteinase 1; Antileukoproteinase; Antileukoproteinase1; BLPI; Human seminal protease inhibitor; HUSI 1; HUSI; HUSI I; HUSI-1; MPI; Mucus proteinase inhibitor; Protease inhibitor WAP4; Secretory leukocyte peptidase inhibitor; Secretory leukocyte protease inhibitor; Seminal proteinase inhibitor; SLPI; SLPI_HUMAN; WAP four disulfide core domain protein 4; WAP four-disulfide core domain protein 4; WAP4; WFDC4
Species Homo sapiens (Human)
Source E.coli
Expression Region 26-132aa
Target Protein Sequence SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 16.7 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses. Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity. Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells.
Gene References into Functions
  1. Study indicate that SLPI seems to be one of the important immunomodulatory proteins that provide local immune response in cervical mucosa. PMID: 30180755
  2. we investigated the biological effects of SLPI using Cell Counting Kit (CCK)-8, Annexin V/PI apoptosis assay and Caspase-Glo(R) 3/7 assay. The findings revealed that SLPI promoted apoptosis in the Leuk1 and WSU-HN4 cell lines. Mechanistic studies indicated that SLPI, at least in part, regulated cell apoptosis by inhibiting the expression of TNF receptor-associated factor 1 PMID: 29436667
  3. Together, these data support the clinical evaluation of dual angiogenic inhibition of the ALK1 and VEGF pathways in patients with advanced renal cell carcinoma (RCC) . PMID: 28031424
  4. the patients with systemic sclerosis had significantly increased serum levels of SLPI in comparison with the rheumatoid arthritis patients and the healthy controls PMID: 28606626
  5. gene expression profiling study based on microarray data for the three cell types identified a number of candidates, including LCP1 and GLI, that could be key molecules in the mechanism of SLPI-induced cell migration PMID: 28637988
  6. we show that SLPI acts as a key mediator in regulating the function of hepatic myeloid cells, to promote resolution responses through induction of MerTK expression within the resident macrophage population. PMID: 28450389
  7. these data demonstrate increased anti-inflammatory activity of the SLPI-A16G protein compared with SLPI-WT in a murine model of pulmonary Pseudomonas infection PMID: 26376365
  8. we demonstrated that the oncogenic effect of SLPI may be due to protection of growth factor progranulin from enzymatic cleavage or suppression of castration-resistant prostate cancer (CRPC)cell apoptosis independent of anti-protease activity of SLPI. These findings implicate SLPI as a potential biomarker of resistance to AR inhibition and therapeutic target for CRPC treatment PMID: 26876202
  9. Secretory leukocyte protease inhibitor mediates invasiveness of oral carcinoma cells. PMID: 27238568
  10. The results indicate that SERPINE2 and SLPI play a significant role in the development of papillary thyroid cancer and imply that the evaluation of serum concentrations of both anticoagulant molecules may be considered as additional marker for the differentiation of malignancies during the preoperative diagnosis of patients with thyroid gland tumors. PMID: 28255192
  11. Bronchial epithelial cells have decreased SLPI expression in response to hypoxia. PMID: 25851169
  12. Ongoing herpes simplex virus infection and resultant downregulation of local levels of SLPI may impart a greater susceptibility for keratinocytes to human papillomavirus type 16 infection through the host cell receptor annexin A2. PMID: 26555393
  13. SLPI is an independent predictor for both OS and DSS and a relevant prognostic biomarker in OSCC. PMID: 24764155
  14. The elevations in cervical elafin and SLPI expression in the women with preterm delivery might reflect the local response to the pathogen invasion into the cervix preceding preterm labor. PMID: 25559229
  15. These results demonstrate that SLPI down-regulates pIgR expression through the NF-kappaB signaling pathway by inhibiting degradation of IkappaBbeta protein. PMID: 26239418
  16. Abnormal over-expression of SLPI in pancreatic cancer cells may be associated with the development of disease through its roles in promoting cancer cell survival and proliferation as well as anti-apoptosis. PMID: 25319722
  17. study identifies a distinct immune response in SA characterized by a dysregulated IFN-gamma/SLPI axis that affects lung function. PMID: 26121748
  18. findings support a controlling role for SLPI in NET generation, which is of potential relevance to infectious and autoinflammatory diseases PMID: 25917460
  19. We identify SLPI as a new player in acquisition of microbial hyporesponsiveness by buccal and intestinal epithelium in the first weeks after microbial colonisation. PMID: 25056659
  20. Studies suggest that secretory leukocyte protease inhibitor (SLPI) as a mediator of systemic immune paresis in acute liver failure (ALF). PMID: 25041028
  21. Report presence of SLPI in vaginal secretions and its regulation in response to vaginal microbiota and to the concentrations of antimicrobial and proinflammatory mediators. PMID: 24023032
  22. Both mRNA and protein levels of SLPI were significantly higher in patients with biofilm associated chronic rhinosinusitis (CRS) than those with CRS and no biofilm and controls. PMID: 24121782
  23. These results show that Mycobacterium tuberculosis-induced IFN-gamma down-modulated SLPI levels by signaling through the IFN-gammaR in healthy donors. PMID: 24606882
  24. SLPI has antiprotease activity and antimicrobial activity against bacteria and fungi. SLPI is an important molecule in the functioning of the innate immune system. PMID: 16336202
  25. findings demonstrate that SLPI plays an important role from the initial stages of lung carcinogenesis to the progression of lung cancer in an NF-kappaB-dependent manner PMID: 24282288
  26. These results indicate that SLPI controls the proliferation, differentiation, and cell cycle of myeloid cells. PMID: 24352879
  27. The aim of this study was to investigate the intracellular function of SLPI and the mechanism-based modulation of neutrophil function by this antiprotease. PMID: 24073410
  28. Low SLPI expression is associated with papillomavirus infected head and neck squamous cell carcinomas. PMID: 23996702
  29. SLPI is bactericidal for gonococci and is expressed by reproductive tract epithelial cells and thus is likely to play a role in the pathogenesis of gonococcal infection. PMID: 22537232
  30. SLPI may contribute to psoriasis by enabling pDCs to sense extracellular DNA and produce IFN type I. PMID: 22786767
  31. Circulating SLPI increases with progressive metabolic dysfunction and is related to metabolic and inflammatory parameters in men PMID: 21377455
  32. confirmed that SLPI is significantly down-regulated in NPC tissues. In addition, based on our preliminary results, we propose that the reduction of SLPI in NPC cells is associated with the presence of the EBV genome and/or expression of EBV-encoded genes PMID: 22493362
  33. decreased expression in female reproductive tract in postmenopausal women with hormonal treatment PMID: 21940052
  34. Results show that SLPI promotes the metastasis of SNU638 gastric cancer cells by increasing MMP-2 and MMP-9 expression through Elk-1 signaling, indicating its role as a signaling molecule not a protease inhibitor. PMID: 21687932
  35. SLPI may possess antitumorigenic activity by virtue of its ability to interfere with multiple requisite proteolytic steps underlying tumor cell invasion. PMID: 21641406
  36. SLPI stimulates ovarian cancer invasion, modulated in part by its serine protease inhibitory activity attenuating MMP-9 release. PMID: 21676452
  37. The results presented here clearly indicate the repression of SLPI, measurable on both, mRNA and protein levels in metastatic primary HNSCC as compared to non-metastatic HNSCC. PMID: 21503571
  38. Constitutive expression of SLPI directly reduces the inflammatory response in the respiratory tract and improves lung function in an acute model of allergic asthma in SLPI transgenic and knockout mice. PMID: 21335488
  39. these findings indicate upregulation of SLPI in response to LPS in nasal secretions and show anti-apoptotic effects of SLPI in primary human neutrophils suggesting a new role of SLPI during neutrophilic inflammation. PMID: 21077989
  40. SLPI inhibited the expression of MMP-9 and IL-8 in normal human bronchial epithelial cells induced by cigarette smoke extract. PMID: 18953959
  41. 17Beta-estradiol inhibits IL-8 in cystic fibrosis by up-regulating secretory leucoprotease inhibitor PMID: 20378727
  42. Our observations are the first to implicate SPARC, SLPI, and NLRP2, a component of the innate immune system, in the pathogenesis of axial spondyloarthropathy PMID: 19900269
  43. Secretory leukocyte protease inhibitor antagonizes paclitaxel in ovarian cancer cells, and contribute to drug resistance. PMID: 20068074
  44. Using transgenic mice over-expressing secretory leukocyte protease inhibitor, this study shows an early protective effect after spinal cord contusion injury. PMID: 20047904
  45. Synthesized locally at mucosal sites. Efficiently inhibit target enzymes released into interstitium. Might be important in controlling excessive neutrophil elastase release in chronic obstructive pulmonary disease and cystic fibrosis. (review) PMID: 11667971
  46. Secretory leukocyte protease inhibitor in punch biopsies from human colonic mucosa. PMID: 11759111
  47. possible role in the defence against ascending urinary tract infections; establishing a source of SLPI in renal tubuli cells. PMID: 11817677
  48. Secretory leukocyte proteinase inhibitor and elafin are resistant to degradation by MMP-8. PMID: 11868825
  49. results indicate that menstrual status (pre- vs. postmenopausal) influences the production of SLPI and bactericidal activity by uterine epithelial cells PMID: 12023766
  50. mediates proliferation of human endometrial epithelial cells by positive and negative regulation of growth-associated genes PMID: 12023969

Show More

Hide All

Subcellular Location Secreted.
Tissue Specificity Detected in blood plasma. Detected in bone marrow myeloid cells. Detected in airway sputum. Detected in parotid gland secretions. Detected in seminal plasma (at protein level). Detected in uterus cervix.
Database Links

HGNC: 11092

OMIM: 107285

KEGG: hsa:6590

STRING: 9606.ENSP00000342082

UniGene: Hs.517070

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1