Recombinant Human Arylamine N-acetyltransferase 2(NAT2)

In Stock
Code CSB-EP015471HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P11245
Lead Time 3-7 business days
Relevance Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Arylamide acetylase 2 N-acetyltransferase type 2 Short name: NAT-2 Polymorphic arylamine N-acetyltransferase Short name: PNAT
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI
Research Area Signal Transduction
Source E.coli
Gene Names NAT2
Protein Names Recommended name: Arylamine N-acetyltransferase 2 EC= 2.3.1.5 Alternative name(s): Arylamide acetylase 2 N-acetyltransferase type 2 Short name= NAT-2 Polymorphic arylamine N-acetyltransferase Short name= PNAT
Expression Region 1-290aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 49.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
Subcellular Location Cytoplasm
Protein Families Arylamine N-acetyltransferase family
Database Links

HGNC: 7646

OMIM: 243400

KEGG: hsa:10

STRING: 9606.ENSP00000286479

UniGene: Hs.2

Related Products

NAT2 Antibodies

NAT2 Antibodies for Homo sapiens (Human)

NAT2 Antibodies for Human

NAT2 Proteins

NAT2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.