Recombinant Human Arylamine N-acetyltransferase 2(NAT2)

In Stock
Code CSB-EP015471HU
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names NAT2
Uniprot No. P11245
Research Area Signal Transduction
Alternative Names AAC2; ARY2_HUMAN; Arylamide acetylase 2 (N-acetyltransferase 2, isoniazid inactivation); Arylamide acetylase 2; Arylamine N-acetyltransferase 2; HGNC:7646; N-acetyltransferase 2 (arylamine N-acetyltransferase); N-acetyltransferase type 2; NAT-2; NAT2; PNAT; Polymorphic arylamine N-acetyltransferase
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-290aa
Target Protein Sequence MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 49.5kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
Gene References into Functions
  1. NAT2 genetic polymorphism predisposes children with connective tissue dysplasia to adhesion ileus. PMID: 30479108
  2. It is concluded that the frequency of slow encoding NAT2 haplotype was high among Jordanian volunteers, which may have effects on drug responses and susceptibility to some diseases, such as cancers. PMID: 29173142
  3. We report a high prevalence of NAT 2 slow acetylators in Ethiopians and a conditional NAT2 genotype-phenotype country-of-residence-based discordance implicating a partial phenotype conversion and metabolic adaptation. Gene-environment interactions regulate NAT2 phenotype. PMID: 29589062
  4. NAT2 genetic variants are associated with urinary bladder cancer risk. PMID: 28577040
  5. Letter: in bladder cancer ultra-slow acetylators with the NAT2*6A/*6A genotype have a higher recurrence risk and a shorter recurrence-free time, especially among smokers. PMID: 28040354
  6. NAT2 polymorphism is not associated with passive smoking associated breast cancer risk. PMID: 29071579
  7. NAT2 role in the metabolic detoxification of heterocyclic aromatic amines PMID: 28160022
  8. hydralazine efficacy and safety could be improved by NAT2 genotype-dependent dosing strategies PMID: 29018032
  9. Studied the association between N-acetyl transferase 2 (NAT2)genetic polymorphisms, environmental factors and risk factors in colon or rectal cancer. PMID: 27883249
  10. prevalence impaired glucose tolerance higher in obese children carrying the A803 allele PMID: 27481583
  11. There were significant differences in NAT2(rs1799929, rs1799930) genotype or allele frequencies between the infertile and fertile groups and synergy effects of GSTP1 and NAT2 polymorphisms might lead to significant increase of infertility risk. PMID: 29505746
  12. The increased risk of prostate cancer was observed among individuals with the NAT2 slow acetylator phenotype PMID: 29165164
  13. Genotyping of TB patients from south India for NAT2 gene polymorphism revealed that 58 per cent of the study population comprised slow acetylators. Two-hour INH concentrations differed significantly among the three genotypes. PMID: 28574024
  14. Slow NAT2 acetylators demonstrated a significant association with risk of anti-tuberculosis drug-induced liver injury in Thai patients. PMID: 27725049
  15. The present study demonstrated no association between NAT2 genotype and drug-induced hepatotoxicity in the north Indian patients with tuberculosis. PMID: 28474630
  16. SNP-inferred slow acetylation statuses were significantly associated with an approximately 50% decreased risk of bladder cancer PMID: 27223070
  17. CYP3A4 expression and N-acetyl transferase 2 acetylator phenotype can better identify the patients with higher risk of adverse reactions and can facilitate the improvement of personalized clonazepam therapy and withdrawal regimen. PMID: 27639091
  18. NAT2 genotypes are associated with N-acetylation phenotype variation. PMID: 28653770
  19. NAT2 acetylator genotype has an important role in 4, 4'-methylene bis (2-chloroaniline) metabolism and suggest that risk assessments related to 4, 4'-methylene bis (2-chloroaniline) exposures consider accounting for NAT2 acetylator phenotype in the analysis PMID: 29180287
  20. Review/Meta-analysis: NAT2 slow acetylation genotype is associated with an increased bladder cancer risk in Chinese individuals. PMID: 28182356
  21. six selected NAT2 exonic single nucleotide polymorphisms were genotyped in an independent case-control sample of a Northern Chinese Han population to verify the possible association between NAT2 and schizophrenia. Three (rs1801280T/341C, rs1799930/G590A, and rs1208/A803G) of the six single nucleotide polymorphisms showed significant allele frequency differences between the case and the control groups. PMID: 28187106
  22. Our findings suggested that NAT2 gene polymorphism rs1799931 was associated with decreased risk of acute myeloid leukemia and was likely to be a protective factor against acute myeloid leukemia development. PMID: 29049179
  23. Study reestablished the association between NAT2 SA and isoniazid-induced liver injury in a Singaporean population and demonstrated its clinical validity in prediction of isoniazid-induced liver injury. PMID: 29036176
  24. In non-syndromic cleft lip with or without cleft palate, we found a significant association between the EGF61 (rs4444903) and NSCL/P (P = .01) genes. Conversely, NAT2 (rs1799929) was not significantly different between the cases and the control group PMID: 28906376
  25. 182 Hungarian bladder cancer cases and 78 cancer-free controls were investigated. It was not possible to establish a particular impact of NAT2*6A and *7B genotypes (15 cases, 8%, 5 controls, 7%). GSTT1 exerted no marked influence on bladder cancer (negative 21% cases vs. 22% controls). The portion of GSTM1 negative bladder cancer patients was increased (63% cases vs. 54% controls). PMID: 28696897
  26. Various antitubercular isoniazid dosing regimens have been proposed for NAT2-specific immunocompetent and immune-deficient patient populations. PMID: 27480867
  27. Data suggest that metabolism (and possibly pharmacokinetics) of hypnotic nitrazepam involves liver enzymes AOX1 (aldehyde oxidase 1), NAT2 (N-acetyltransferase 2), AADAC (arylacetamide deacetylase), and CYP3A4 (cytochrome P450 3A4). PMID: 28606603
  28. The multicolor melting curve assay described in our study is very promising for the efficient determination of NAT2 genotype, and can facilitate the personalized dosing of isoniazid PMID: 27377479
  29. No significant differences in the acetylator NAT2 haplotype and phenotype distributions were found between Native American populations practicing farming and/or herding and those practicing hunting and gathering. PMID: 26503810
  30. In any patient who may receive INH and happens to be NAT2 slow acetylator type, NAT2 genotype by covert action may influence the clinical response of above drugs. PMID: 27487996
  31. Homozygous mutant allele of NAT2 gene at 481site may act as a predisposing factor for phenytoin intoxication among tuberculous meningitis or tuberculoma patients having seizures. PMID: 27488001
  32. In the present study, we report that the most common NAT2 haplotype in the Korean population (TACGAGG; frequency = 47.6%) is associated with a low expression level of NAT2. We failed to find a significant relationship between rs4646241 and enzyme expression level. Haplotypes of Caucasian and African populations were markedly different from those of the Korean population. PMID: 27853051
  33. We genotyped four selected variants of the NAT2 gene (NAT2*5, NAT2*6, NAT2*7, and NAT2*14) by Sanger sequencing. The majority of patients had NAT2 genotypes previously described as slow acetylators including NAT2*5/*5, NAT2*5/*6, NAT2*6/*6, and NAT2*6/*14 (78%) and none were genotyped as rapid acetylators. Controls were slow, intermediate, and rapid acetylators with frequencies of 72.39%, 21.48%, and 6.13%, respectively PMID: 27541622
  34. this study confirms the significance of the association between slow-acetylator NAT2 variants and susceptibility to AT-DILI in an Indonesian population. PMID: 26911349
  35. NAT2 gene variants were associated with antituberculosis drug-induced hepatotoxicity. PMID: 27104815
  36. Single nucleotide polymorphism is associated with different N-acetyltransferase-2 acetylator phenotypes in wordwide population groups. PMID: 27136043
  37. Association of NAT2 single nucleotide polymorphism and breast cancer risk with smoking in Japanese women PMID: 27068825
  38. NAT2 slow acetylators have a higher risk of noncardiac gastric adenocarcinoma than intermediate and rapid acetylators have in a Taiwanese population. PMID: 26617241
  39. NAT2 single nucleotide polymorphism associated with the risk bladder cancer development and interacts with smoking. PMID: 27495060
  40. NAT2 gene polymorphisms (rs1041983 C/T, rs1801280 T/C, and rs1799930 G/A) in association with long-period active smoking could be the possible individual risk-predicting factors for breast cancer development in the population of Slovak women PMID: 26700672
  41. Data on NAT2 gene polymorphisms obtained from the current meta-analysis do not support a major association with Parkinson's diease risk, except in Asian populations PMID: 27216438
  42. Results show that NAT2 polymorphism was associated with increased risk of coronary heart disease in Chinese population. PMID: 26985933
  43. NAT2 acetylation status and its single nucleotide polymorphisms in the Greenlandic population, including Inuit and European ancestry PMID: 25794903
  44. Results showed that the NAT2 slow acetylation phenotypes are significantly associated with an increased risk of bladder cancer. PMID: 26585839
  45. NAT2 slow acetylation state was associated with bladder cancer risk, and was shown to modestly increase the risk of bladder cancer. PMID: 26681036
  46. the NAT2 slow acetylation genotypes might increase the susceptibility to pancreatic cancer in Europe but that these have no significant effects in the United States and multi-center populations. PMID: 26681215
  47. Findings suggest that variations in the NAT2 gene and their interactions contribute to occupational diisocyanate asthma susceptibility. PMID: 26641831
  48. The results suggest that NAT2 is related to cognitive processes dealing with distraction and attentional control in the auditory modality; ultra-slow acetylation status was associated with reduced higher cognitive functions PMID: 26615528
  49. Individuals with NAT2 slow acetylators may have increased risk of antituberculosis drug-induced liver injury when standard dose of isoniazid was used. [META-ANALYSIS] PMID: 26616266
  50. Findings support a role for NAT2 in modifying the association between red meat consumption and colorectal cancer in Japanese and African Americans. PMID: 26683305
  51. TT genotype in NAT2 C282T polymorphism may be a risk factor for lung cancer susceptibility. Additionally, the acetylator status of 5 SNPs in NAT2 gene may not be associated with lung cancer risk (Meta-Analysis) PMID: 26656326
  52. The pattern of variation of NAT2 in sub-Saharan African food-producing populations differs from that expected under a model of isolation-by-distance or from those observed with other genetic systems, but it is compatible with the hypothesis that it was shaped by selective pressures linked to the chemical environment in which populations evolved. PMID: 26620671
  53. Transmission disequilibrium showed a positive association between allele *5 and non-syndromic Cleft lip with or without cleft palate (odds ratio = 1,6; p = 0,03). PMID: 26204535
  54. N-acetyltransferase 2 gene polymorphism is associated with the susceptibility to bladder cancer. PMID: 25376209
  55. Data show correlation between N-acetyltransferase 2 (NAT2) gene polymorphism and cirrhotic portal hypertension in Chinese patients. PMID: 25574899
  56. Studied the extent to which CYP2B6 and NAT2 polymorphisms were associated increased efavirenz concentrations in black and Hispanic patients enrolled from sub-Saharan Africa and South America. PMID: 25722197
  57. Frequent red meat consumption was associated with increased esophageal cancer risk for the Mixed Ancestry population of South Africa with NAT2 polymorphisms. PMID: 25886288
  58. Results show a higher expression level of NAT2 in innate immune cells from tuberculosis patients and determine the acetylator phenotype mediating NAT2 SNPs in response to anti-tuberculosis therapy in Mexican mestizo population. PMID: 25163630
  59. NAT2 gene polymorphism(s) with slow acetylator phenotype is generally associated with the risk of development of acute lymphoblastic leukemia in children. PMID: 25804798
  60. By analyzing the NAT2 polymorphisms 481T, 590A, and 857A, we were able to ascertain the allelic distributions and pharmacogenetic differences in the Chimila, Wiwa, and Wayuu indigenous groups of the Colombian Caribbean PMID: 25767302
  61. This pilot study found, as far as is known for the first time, that the polymorphism 590G>A of NAT2 is a novel genetic marker for susceptibility to idiopathic male infertility, but the risk is potentiated by exposure to various environmental oxidants. PMID: 24928356
  62. The nonsynonymous substitution c.590G>A (rs1799930) defining the slow NAT2*6 haplotype cluster exhibited an unusually low FST value compared with genome average. The rs1799930 A allele has been associated with the slowest acetylation capacity in vivo. PMID: 25836746
  63. The prevalence of slow acetylators among Moroccan newborns as indicated by allelic and genotypic frequencies of NAT2 and CYP2E1 variants. PMID: 25544508
  64. Differences between murine arylamine N-acetyltransferase type 1 and human arylamine N-acetyltransferase type 2 defined by substrate specificity and inhibitor binding.( PMID: 25432241
  65. Disequilibrium distribution of NAT2 polymorphism was found in lung cancer patients among Han and Mongolian populations. PMID: 25422202
  66. NAT2 polymorphisms determine the metabolic profile and biotransformation of metamizole. PMID: 25241292
  67. In Europeans, the presence of a nonsynonymous variant of N-acetyltransferase 2 (NAT2) [rs1208 (803A>G, K268R)] was strongly associated with decreased insulin sensitivity that was independent of BMI. PMID: 25798622
  68. NAT2 rs1799930 may be a risk factor, while the NAT2 rs1799931 polymorphism is associated with a decreased risk of cancer and is likely a protective factor against cancer development. PMID: 25081676
  69. Dapsone-associated methemoglobinemia in a patient with slow NAT2*5B haplotype and impaired cytochrome b5 reductase activity PMID: 21422237
  70. Given a marked effect of NAT2 phenotype on etamicastat pharmacokinetics, participants' stratification and/or dose adjustment of etamicastat on the basis of NAT2 phenotype should be considered in future clinical trials PMID: 21343348
  71. NAT2 rs1799930 polymorphism is an important factor of lung squamous carcinoma resistance in Chinese smoking males. PMID: 25005845
  72. NAT2 phenotypes whether alone or in association with smoking do not correlate with susceptibility to prostate cancer within the Slovak population. PMID: 24816842
  73. Polymorphic variants of GSTP1,GSTM1,GSTP1, and NAT2 genes were accociated with development of occupational lung cancer. PMID: 25775823
  74. The NAT2 slow acetylator genotype appears to be a significant risk factor for moderate and severe drug- induced liver injury PMID: 24888881
  75. We have developed a novel method for NAT2 haplotyping using allele-specific sequencing, which could be an innovative and reliable method for NAT2 haplotyping. PMID: 25084204
  76. Interaction between metabolic rates of phytoestrogens and genetic polymorphisms of CYP2B6, CYP1A1, and NAT2 in male infertility. PMID: 24488272
  77. GWAS identified robust association between NAT2 and skin fluorescence(SF)in people with and without diabetes; findings provide proof of principle that genetic variation contributes to interindividual SF and that NAT2 acetylation status plays a major role PMID: 24934506
  78. No significant associations (P value, > 0.05) were observed between the N-acetyltransferase 2 or apolipoprotein E gene polymorphisms and any hearing factor. PMID: 25155015
  79. he slow acetylation phenotype, determined by polymorphisms within NAT2, influenced both the antihypertensive and adverse effects of hydralazine in resistant hypertension . PMID: 24444407
  80. The carriers of the NAT2*7 allele which determines slow acetylation may be more predisposed to inflammatory bowel diseases, including ulcerative colitis and Crohn's disease. PMID: 24948072
  81. this is the first report of a suggestive association between NAT2*6 and gastroschisis risk for Hispanic non-smoking mothers and their infants PMID: 24668907
  82. The present meta-analysis indicates that the CYP2E1 c1/c1 genotype may be a risk factor for anti-tuberculosis drug-induced hepatotoxicity, and the concomitant presence of the slow acetylator NAT2 genotype may further increase this risk. PMID: 24607341
  83. Results show that polymorphism in NAT2 is a risk factor for antitubercular agent induced hepatotoxicity PMID: 24637014
  84. NAT2 slow acetylator phenotype was a significant risk factor of ESCC in Asian populations. PMID: 24595082
  85. NAT2 rs1565684 T>C SNP might play a slight role in ESCC etiology PMID: 24586291
  86. Liver injury in antitubercular drug treated patients is associated with genetic variants in the NAT2 gene. PMID: 24465778
  87. The pooled data suggest that slow acetylators of NAT2 might contribute to asthma risk among Caucasians. PMID: 24442317
  88. Genetic variants in NAT2 are associated with pharmacokinetic variation of isoniazid, the cornerstone of antituberculosis treatment. PMID: 24533708
  89. Our pooled data suggest that the NAT2 acetylation status has an effect on the risk of gastric cancer among East Asian populations. PMID: 25051916
  90. NAT2 5/7 and 6/7 were significantly higher in hepatotoxicity patients. PMID: 24188272
  91. NAT2 polymorphism significantly modifies the effects of alcohol use and black tea consumption on systemic lupus erythematosus (SLE), emphasizing the importance of incorporating genetic and metabolic information in studies on management of SLE PMID: 24470392
  92. In India, the risk of ATDH is increased in persons with 'A' allele at SNP rs1799930 in the NAT2 gene, but is not associated with rs2031920 polymorphism in the CYP2E1 gene. PMID: 25017831
  93. Interactions involving NAT2, XRCC1 Arg399Gln and hOGG1 Ser326Cys polymorphisms may modulate the risk of UADT cancer. PMID: 24922697
  94. Determining mutations in the NAT2 gene enabled the identification of the isoniazid acetylation type in TB patients and the genotyping results were consistent with the phenotype determined by methods of measurement of drug bioavailability. PMID: 24383060
  95. NAT2 acetylator genotype, the CYP1A2 polymorphism, and intakes of heterocyclic amines, meat-derived mutagenicity, and red meat were not associated with risk of postmenopausal breast cancer. PMID: 24099317
  96. this study suggests that NAT2 phenotype prediction should be refined by consideration of an 'ultra-slow' acetylation genotype PMID: 24221535
  97. High coffee and tea consuming subjects with slow CYP1A2 or NAT2 activity had a similar CRC risk compared to non/low coffee and tea consuming subjects with a fast CYP1A2 or NAT2 activity PMID: 24318358
  98. NAT2 polymorphism might be a low-penetrant risk factor for HNC among Asians PMID: 24338712
  99. NAT2 genotyping was performed by RFLP technique, searching for common polymorphisms PMID: 24447650
  100. results suggest that the NAT2 status has a differential effect on the association of active and passive smoking with breast cancer PMID: 24791559

Show More

Hide All

Subcellular Location Cytoplasm
Protein Families Arylamine N-acetyltransferase family
Database Links

HGNC: 7646

OMIM: 243400

KEGG: hsa:10

STRING: 9606.ENSP00000286479

UniGene: Hs.2

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1