Recombinant Human Caveolin-3(CAV3)

Code CSB-EP004573HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CAV3
Uniprot No. P56539
Research Area Signal Transduction
Alternative Names CAV3; CAV3_HUMAN; Caveolin 3; Caveolin-3; LGMD1C; LQT9; M-caveolin; MGC126100; MGC126101; MGC126129; OTTHUMP00000115603; OTTHUMP00000207105; VIP 21; VIP21
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-151aa
Target Protein Sequence MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 44.3kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress (By similarity). Mediates the recruitment of CAVIN2 and CAVIN3 proteins to the caveolae
Gene References into Functions
  1. T78M cav-3 induces complex modifications in ion channel function that ultimately alter membrane excitability and thus generate a susceptible substrate that, in concert with other structural alterations and/or genetic mutations, may become arrhythmogenic. PMID: 28898996
  2. Case series demonstrates that exercise intolerance, myalgia and rhabdomyolysis may be caused by CAV3 mutations and broadens phenotypic spectrum of caveolinopathies. Percussion-induced rapid muscle contractions were seen in 5 of 6 patients. A previously reported heterozygous mutation in CAV3 (p.T78M) and 3 novel variants (p.V14I, p.F41S, p.F54V) were identified. >50% reduction of caveolin-3 in 5 patients vs controls. PMID: 27312022
  3. our study indicates that TASK-1 is functionally regulated by caveolin-3, possibly via association with each other on the cell surface. These results point out a novel mechanism in the regulation of TASK-1. PMID: 28648645
  4. The caveolin 3 G56S variant is not a clearly pathogenic mutation, but may influence cellular functions and morphologies resulting in an increased cellular vulnerability in terms of a modifying factor. PMID: 27739254
  5. Our results indicate that HCN4 channel function is modulated by cav-3. LQTS-associated mutations of cav-3 differentially influence pacemaker current properties indicating a pathophysiological role in clinical manifestations. PMID: 28648120
  6. This study demonstrated that the Caveolin-3 is aberrantly expressed in skeletal muscle cells in myasthenia gravis. PMID: 27863830
  7. Study characterized the secondary structure, dynamics, and topology of a lipidated full-length human Cav3 construct, demonstrated that the N-terminal domain undergoes a dramatic topological rearrangement in both micelles and vesicles that is reversibly mediated by pH PMID: 27276265
  8. The Cav3 P104L mutation of limb girdle muscular dystrophy-1C leads to disordered glucose metabolism in muscle cells. PMID: 28232187
  9. Data (including data from studies using recombinant proteins that lack typical in-vivo post-translational modifications such as palmitoylation) suggest Cav3 exhibits little tendency to partition into liquid-ordered domains of unilamellar vesicles. PMID: 26859249
  10. MURC/cavin-4, especially in combination with Cav-3, may play a consistent role in the differentiation process of rhabdomyosarcoma. PMID: 26086601
  11. This study demonstrated that cav3 mutation in stinct disorders including limb-girdle muscular dystrophy 1C, rippling muscle disease, and isolated creatine kinase elevation in Greece. PMID: 26185955
  12. In a nonreferred nationwide Danish cohort of SIDS cases, up to 5/66 (7.5%) of SIDS cases can be explained by genetic variants in the sodium channel complex genes. PMID: 25757662
  13. We identified three novel sequence variations (c.183C>G, p.S61R; c.220C>A, p.R74S; c.220C>T, p.R74C) and found evidence that one was associated with hypercreatine kinase-emia PMID: 25630502
  14. our results indicate that inhibition of Cav3 currents by 5,6-epoxyeicosatrienoic acid is an important mechanism controlling the vascular tone. PMID: 24327205
  15. detrimental effect of Cav-3 V82I variant on cell viability may participate in determining the susceptibility to cardiac death. PMID: 24917393
  16. The caveolin-3:p.T78M did not exhibit a long-QT syndrome phenotype. PMID: 24021552
  17. Cav3 is an important negative regulator for cardiac late sodium cutrrent via nNOS dependent direct S-nitrosylation of SCN5A. PMID: 23541953
  18. data show a developmental change in HCN4-Cav3 association in human embryonic stem cell-derived cardiomyocytes. Cav3 expression and its association with ionic channels likely represent a crucial step of cardiac maturation PMID: 23311301
  19. A very high prevalence of previously SIDS-associated variants was identified in exome data from population studies. PMID: 23465283
  20. Kir2.1 loss of function is additive to the increase in late sodium current, prolonging repolarization and leading to arrhythmia generation in Cav3-mediated long qt syndrome 9. PMID: 23640888
  21. These results strongly suggest that cav3 possesses direct interaction with KCa1.1, presumably at the same domain for cav1 binding. PMID: 23237801
  22. Multiple caveolin-3 nonamers bind to a single RyR1 homotetramer. PMID: 23071107
  23. hERG expression in the plasma membrane is regulated by Cav3 via Nedd4-2 PMID: 22879586
  24. Stromal caveolin-3 expression were more frequent in anaplastic carcinoma and diffuse sclerosing variant of papillary carcinoma compared to conventional papillary thyroid carcinoma. PMID: 22236542
  25. Detailed analysis of the voltage-dependence of Ca2+ transients revealed a significant shift of Ca2+ release activation to higher depolarization levels in CAV3 mutated cells. PMID: 21294223
  26. Caveolin 3 expression was decreased in an animal model of left ventricular dysfunction and heart failure. PMID: 21362533
  27. Cav-3 is SUMOylated in a manner that is enhanced by the SUMO E3 ligase PIASy; Cav-3 SUMOylation in the mechanisms for beta(2)AR but not beta(1)AR desensitization PMID: 21362625
  28. -3 defects lead to four distinct skeletal muscle disease phenotypes: limb-girdle muscular dystrophy, rippling muscle disease, distal myopathy, and hyperCKemia[review] PMID: 21496630
  29. functional modulation of the Ca(v)3.2 channels by Cav-3 is important for understanding the compartmentalized regulation of Ca(2+) signaling during normal and pathological processes. PMID: 21084288
  30. Results describe differential effects of the R26Q and P28L caveolin-3 mutants on growth factor signaling. PMID: 20472890
  31. Impaired muscle contraction in gallbladders with cholesterol stones is due to high caveolar levels of cholesterol that inhibits CAV-3 generation; cholesterol increases the caveolar sequestration of CAV-3 and CCK-1R. PMID: 20558763
  32. Genetic analysis revealed a CAV3 c.G136A transition resulting in an A46T missense mutation in a family with rippling muscle disease. PMID: 20229577
  33. Caveolin-3 (Cav3) is a new Cx43-interacting protein. PMID: 19544087
  34. Review addresses caveolin-3 biological functions in muscle cells and describes the muscle and heart disease phenotypes associated with caveolin-3 mutations[REVIEW] PMID: 19584897
  35. A heterozygous 80 G-->A substitution in the caveolin-3 gene is associated with sporadic distal myopathy PMID: 11805270
  36. A naturally occurring caveolin-3 mutation can inhibit signaling involving cholesterol-sensitive raft domains. PMID: 11884389
  37. P28L mutation in the CAV-3 gene and the consequent caveolin-3 deficiency is associated with elevated serum kreatine kinase levels. PMID: 12082049
  38. Effects of deleting a tripeptide sequence observed in muscular dystrophy patients on the conformation of peptides corresponding to the scaffolding domain of caveolin-3. PMID: 12387816
  39. caveolin-3 may play a role in lamellar granule assembly, trafficking, and/or function. PMID: 12648214
  40. severe form of rippling muscle disease associated with homozygous CAV3 mutations. PMID: 12666119
  41. A haploinsufficiency model is proposed in which reduced levels of wild-type caveolin-3, although not rendered dysfunctional due to the caveolin-3 R26Q mutant protein, are insufficient for normal muscle cell function. PMID: 12839838
  42. Adenovirus-mediated overexpression of human caveolin-3 inhibits hypertrophic responses in rat cardiomyocytes. PMID: 12847114
  43. An R27Q missense mutation in the CAV3 gene can lead to various clinical phenotypes including hyper-CK-emia, rippling muscle disease, distal myopathy, and limb-girdle musclar dystrophy 1C. PMID: 12939441
  44. CD36 colocalizes with caveolin-3, suggesting that caveolae may regulate cellular fatty acid uptake by CD36. CD36 expression is higher in type 1 compared with type 2 fibers, whereas caveolin-3 expression is significantly higher in type 2 than in type 1 PMID: 14729862
  45. the importance of dysferlin-caveolin 3 relationship for skeletal muscle integrity PMID: 14749532
  46. Review. Caveolin-3 mutations can result in four distinct, sometimes overlapping, muscle disease phenotypes: limb girdle muscular dystrophy, rippling muscle disease, distal myopathy, and hyperCKemia. PMID: 14981167
  47. A muscle biopsy showed a partial reduction of caveolin-3 at the sarcolemma of muscle fibres.Mutational analysis identified a novel heterozygous mutation and generating a Val-->Met change at codon 57 of the amino acid chain. PMID: 15099591
  48. demonstrate that Cav-3 is specifically expressed in human cardiac and skeletal myocytes, with high specificity and relatively high sensitivity (88%) for tumors with skeletal muscle differentiation PMID: 16082247
  49. The authors describe a family with autosomal dominant rippling muscle disease (RMD) and prominent early-onset toe walking. Molecular analysis revealed a novel heterozygous G > A transition at nucleotide position 136 in exon 2 of the caveolin-3 gene. PMID: 16247063
  50. The co-localization of Cav-3 with COX-2 in the caveolae suggests that the caveolins might play an important role for regulating the function of COX-2. PMID: 16479074
  51. CAV3 identified and immunolocalized in the caveola-vesicle complexes (CVC )present in erythrocytes infected with P. vivax PMID: 16521037
  52. Our findings suggest that caveolin exhibits growth inhibition in a Ca2+-dependent manner, most likely through PKC, in cardiac myoblasts. PMID: 16563233
  53. Our findings contribute to the clarification of unexplained persistent hyper-CK-emia, but further research is needed before CAV3 gene mutation analysis becomes part of the routine evaluation of these patients. PMID: 16770780
  54. caveolin-3 normally suppresses the myostatin-mediated signal PMID: 17039257
  55. Reports of first CAV3 mutations in subjects with long-QT syndrome and functional data demonstrating gain-of-function increase in late sodium current. PMID: 17060380
  56. We demonstrated that 9.5% of cases diagnosed as SIDS carry functionally significant genetic variants in LQTS genes (KCNQ1, KCNH2, SCN5A, KCNE1, KCNE2, KCNJ2, CAV3). PMID: 17210839
  57. the first molecular and functional evidence implicating CAV3 as a pathogenic basis of Sudden infant death syndrome PMID: 17275750
  58. Cav-3 mediates defective gallbladder contraction in the presence of cholesterol stones. Increased expression of Cav-3 results in the sequestration of CCK-1 receptors in the caveolae, probably by inhibiting the functions of Galpha(i3) proteins. PMID: 17307729
  59. Molecular analysis revealed a novel heterozygous A>C transition at nucleotide position 140 in exon 2 of the caveolin-3 gene in 17-year-old patient with rippling muscle disease. PMID: 17405141
  60. We encountered a Korean male patient with RMD who had suffered from muscle stiffness for 3 years. Mutation analysis of the CAV3 gene revealed the patient to be heterozygous for a novel in-frame deletion mutation. PMID: 17524427
  61. This study describe a 39-year-old Japanese man with rippling muscle disease who carried a novel homozygous mutation (Trp70 to a stop codon) in the caveolin-3 gene. PMID: 17537631
  62. Caveolin 3 missense mutations lead to different phenotypes in vivo and in vitro. PMID: 18253147
  63. Here, we report the clinical, morphological and molecular analysis of a patient with autosomal-recessive RMD carrying two novel compound heterozygous CAV3 mutations that lead to a severe protein truncation. PMID: 18487559
  64. Expression of the muscular dystrophy-associated caveolin-3(P104L) mutant in adult mouse skeletal muscle specifically alters the Ca(2+) channel function of the dihydropyridine receptor. PMID: 18509671
  65. Two novel missense mutation in the CAV3 gene in Neuromuscul Disord. PMID: 18583131
  66. Mutation analysis revealed a novel heterozygous missense mutation in the caveolin-3 gene (c.79C > G; p.Arg27Gly) in both the index patient diagnosed with rippling muscle disease and his mother fasely diagnosed with acid maltase deficiency. PMID: 18671188
  67. Genetic studies revealed a G --> A transition at nucleotide position 80 in exon 1 of the Cav-3 gene (c.80G>A), generating a Arg --> Gln change at codon 27 (p.R27Q) of the amino acid chain in heterozygous state in this case. PMID: 18930476
  68. Confocal immunofluorescence microscopy shows that caveolin-3 is present throughout the t-tubule system in skeletal muscle fibers, with 'hot-spots' at the necks of the tubules in the sub-sarcolemmal space. PMID: 19101541
  69. Cav-3 levels were unchanged from the resting levels after both exercise trials in deltoid PMID: 19219452
  70. HCN4 associates with Cav3 to form a HCN4 macromolecular complex. Our results also indicated that disruption of caveolae using P104L alters HCN4 function and could cause a reduction of cardiac pacemaker activity. PMID: 19238754
  71. Molecular complex formed by MG53, dysferlin, and Cav3 is essential for repair of muscle membrane damage in muscular dystrophy. PMID: 19380584
  72. caveolin-3 negatively regulates Kir6.2/SUR2A channel function. PMID: 19481058
  73. cardiac dysfunction in myopathic patients with CAV3 mutations(A46V)may be underestimated and recommend a more thorough evaluation for the presence of cardiomyopathy and potentially lethal arrhythmias. PMID: 19773168

Show More

Hide All

Involvement in disease Limb-girdle muscular dystrophy 1C (LGMD1C); HyperCKmia (HYPCK); Rippling muscle disease 2 (RMD2); Cardiomyopathy, familial hypertrophic (CMH); Long QT syndrome 9 (LQT9); Sudden infant death syndrome (SIDS); Myopathy, distal, Tateyama type (MPDT)
Subcellular Location Golgi apparatus membrane, Peripheral membrane protein, Cell membrane, Peripheral membrane protein, Membrane, caveola, Peripheral membrane protein, Cell membrane, sarcolemma
Protein Families Caveolin family
Tissue Specificity Expressed predominantly in muscle.
Database Links

HGNC: 1529

OMIM: 123320

KEGG: hsa:859

STRING: 9606.ENSP00000341940

UniGene: Hs.98303

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1