Recombinant Human Chromobox protein homolog 5 (CBX5)

In Stock
Code CSB-EP004601HU
Abbreviation Recombinant Human CBX5 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
CBX5
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Antigen p25; CBX5; CBX5_HUMAN; CG8409; Chromobox 5; Chromobox homolog 5 (HP1 alpha homolog; Drosophila); Chromobox homolog 5; Chromobox protein homolog 5; Epididymis luminal protein 25; HEL25; Heterochromatin protein 1 alpha; Heterochromatin protein 1; Heterochromatin protein 1 homolog alpha; HP1 alpha; HP1 alpha homolog; HP1; HP1A; HP1Hs alpha; Su(var)205
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-191aa
Target Protein Sequence
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process for recombinant Human CBX5 protein synthesis in e.coli cells includes recombining the DNA fragment that encodes the Human CBX5 protein (1-191aa) into expression vector, transforming the recombinant vector into e.coli cells, screening positive cells, cultivating and inducing cells, conducting cell lysis, and performing expression analysis. The resulting recombinant Human CBX5 protein is purified from the cell lysate using affinity purification, with its purity exceeding 85% as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.
Gene References into Functions
  1. We have focused on interactions between HP1alpha and the chromosomal passenger complex (CPC) in mitosis and interphase. Our studies artificially tethering HP1alpha to centromeres revealed a robust interaction between this protein and the CPC. PMID: 29467217
  2. These data indicates that up-regulated HP1alpha, SUV39H1, and H3K9me3 in glioma cells are functionally associated with glioma pathogenesis and progression, and may serve as novel biomarkers for future diagnostic and therapeutic targeting of brain tumors. PMID: 28946550
  3. Data suggest that SUMOylated heterochromatin protein 1-alpha (HP1alpha)alpha is a critical epigenetic-regulator of DNA-repair in breast cancer (BCa) that could define chemotherapy responsiveness. PMID: 27107417
  4. findings suggest that heterochromatin-mediated gene silencing may occur in part through sequestration of compacted chromatin in phase-separated HP1 droplets, which are dissolved or formed by specific ligands on the basis of nuclear context PMID: 28636604
  5. Data show that SALL4 promotes the expression of Glut1 and open chromatin through a HP1alpha-dependent mechanism. PMID: 28759035
  6. These data suggests that up-regulated HP1A and H3K9me3 in glioma cells are functionally associated with glioma pathogenesis and progression. PMID: 28623138
  7. Loss of HP1alpha and gamma isoforms inhibits the upregulation of Suv39h1 and H3K9me3 that is observed under stress conditions. PMID: 28059589
  8. we showed the essential role of HP1 in regulating HR through BRCA1/BARD1-mediated accumulation of FANCJ and CtIP at DSB sites. This mechanism may affect tumorigenesis and chemosensitivity and is thus of high clinical significance. PMID: 27399284
  9. the dynamic string-like behavior of HP1alpha's N-terminal tail underlies the enhancement in H3 binding due to phosphorylation. PMID: 26934956
  10. We demonstrate that an hnRNPA1 and CBX5 bi-directional core promoter fragment does not comprise intrinsic capacity for specific CBX5 down-regulation in metastatic cells PMID: 26791953
  11. HP1alpha plays an important role in the differentiation and angiogenic function of Endothelial Progenitor Cells. PMID: 25588582
  12. Jra recruits the HP1a/KDM4A complex to its gene body region upon osmotic stress to reduce H3K36 methylation levels and disrupt H3K36 methylation-dependent histone deacetylation PMID: 25945750
  13. HP1 regulates this gene's alternative splicing in a methylation-dependent manner by recruiting splicing factors to its methylated form. PMID: 25704815
  14. PIP5K1A modulates ribosomal RNA gene silencing through its interaction with histone H3 lysine 9 trimethylation and heterochromatin protein HP1-alpha. PMID: 26157143
  15. Paternal heterochromatin formation in human embryos is H3K9/HP1 directed and primed by sperm-derived histone modifications. PMID: 25519718
  16. The results suggested that HP1 phosphorylation has an evolutionarily conserved role in HP1's recognition of H3K9me-marked nucleosomes. PMID: 25332400
  17. Heterochromatin protein 1 (HP1) is an evolutionarily conserved chromosomal protein that binds lysine 9-methylated histone H3 (H3K9me), a hallmark of heterochromatin, and plays a crucial role in forming higher-order chromatin structures. PMID: 24825911
  18. CRL4B promotes tumorigenesis by coordinating with SUV39H1/HP1/DNMT3A in DNA methylation-based epigenetic silencing PMID: 24292684
  19. RAD6 physically interacts with heterochromatin protein 1alpha and ubiquitinates HP1alpha at residue K154, thereby promoting heterochromatin protein 1alpha degradation through the autophagy pathway PMID: 25384975
  20. These findings reveal a previously unrecognized but direct link between HP1 and CPC localization in the centromere and illustrate the critical role of borealin-HP1 interaction in orchestrating an accurate cell division. PMID: 24917673
  21. Spatiotemporal dynamics of HP1A localization to centromere is governed by two distinct structural determinants. PMID: 25104354
  22. The phosphorylation-dephosphorylation cycle of HP1alpha orchestrates accurate progression of cells through mitosis. PMID: 24786771
  23. Binding of HP1alpha, HP1beta, and HP1gamma to the globular domain of histone H3 is differentially regulated by phosphorylation of residues H3T45 and H3S57. PMID: 24820035
  24. CTCF may regulate vigilin behavior and thus indirectly influence the binding of HP1alpha to the satellite 2 locus. PMID: 24561205
  25. these findings demonstrate that HP1(Hsalpha)-nucleosome interactions cause chromatin condensation, a process that regulates many chromosome events. PMID: 24415761
  26. HP1alpha mutation W174A, which disrupts interactions with proteins containing the PxVxL motif did not affect interactions with the BZip protein. The HP1alpha W41A mutation, which prevents binding to methylated histones, exhibited greatly reduced FRET efficiency. PMID: 23392382
  27. HP-1alpha/beta may be useful in the differential diagnosis of renal tumors, especially in the differentiation of chromophobe RCC and oncocytoma PMID: 23142018
  28. We have identified CBX5 as a potential target regulating lung cancer survivals and the stem-like properties of lung CD133+- tumor stem-like cells (TSLCs). PMID: 22900142
  29. The hinge region (HR) connecting the CD and C-terminal chromoshadow domain (CSD), and the CSD contributed to the selective binding of HP1alpha to histone H3 with trimethylated lysine 9 through weak DNA binding and by suppressing the DNA binding, respectively. PMID: 23142645
  30. HP1-alpha and PADI4 are regulators of both immune genes and HERVs, and that multiple events of transcriptional reactivation in Multiple Sclerosis patients can be explained by the deficiency of a single mechanism of gene silencing. PMID: 23028349
  31. Downregulation of the telomeric noncoding RNA requires SUV39H1 and HP1A. PMID: 22922742
  32. These studies reveal a novel role for HP1 as a cofactor in tumor suppression, expand our mechanistic understanding of a KLF associated to human disease. PMID: 22318730
  33. HP1 increases the chromatin association of VHL. PMID: 22234250
  34. The finding that HP1 alpha is down-regulated primarily at the transcriptional level provides a new insight for the further elucidation of the detailed molecular mechanisms causing the HP1 alpha down-regulation in invasive breast cancer cells. PMID: 21374739
  35. A link between mutant codanin-1 and the aberrant localization of HP1 alpha is supported by the finding that codanin-1 can be coimmunoprecipitated by anti-HP1 alpha antibodies erythroblasts from patients with congenital dyserythropoietic anemia type 1. PMID: 21364188
  36. HP1alpha binding by INCENP or Shugoshin 1 (Sgo1) is dispensable for centromeric cohesion protection during mitosis of human cells, but might regulate yet unknown interphase functions of the chromosome passenger complex (CPC) or Sgo1 at the centromeres. PMID: 21346195
  37. Recent findings and controversies concerning HP1 functions in mammalian cells in comparison to studies in other organisms, are reviewed. PMID: 20421743
  38. ATRX185 is required for HP1a deposition in pericentric beta-heterochromatin of the X chromosome PMID: 20154359
  39. The assembly of HP1 in the inner centromere and the localization of hMis14 at the kinetochore are mutually dependent in human chromosomes. PMID: 20231385
  40. data suggest that HP1 chromoshadow-domains can benefit from the opening of nucleosomal structures to bind chromatin and that HP1 proteins use this property to detect and arrest unwanted chromatin remodeling PMID: 20011120
  41. HP1alpha expression regulation is dependent on cell proliferation. PMID: 20049717
  42. Heterochromatin protein 1 is extensively decorated with histone code-like post-translational modifications PMID: 19567367
  43. reduction of YY1 expression in breast cancer cells could contribute to the acquisition of an invasive phenotype through increased cell migration as well as by reduced expression of HP1alpha PMID: 19566924
  44. These results suggested that, although the majority of HP1alpha diffuses into the cytoplasm, some populations are retained in the centromeric region and involved in the association and segregation of sister kinetochores during mitosis. PMID: 11942629
  45. identification of three amino acid residues I113, A114 and C133 in HP1alpha that are essential for the selective interaction of HP1alpha with BRG1 PMID: 12411497
  46. developmentally regulated ARL5, with its distinctive nuclear/nucleolar localization and interaction with HP1alpha, may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development PMID: 12414990
  47. histone H3 methylase Suv39h1 and the methyl lysine-binding protein HP1alpha directly interact with MBD of MBD1 in vitro and in cells PMID: 12711603
  48. HP1 has a role in the recruitment but not in the stable association of Orc1p with heterochromatin PMID: 15454574
  49. HP1alpha recruits endogenous HP1beta to the chromatin and this induces heterochromatin formation and enhanced histone lysine methylation. PMID: 15899859
  50. Results describe the predominant nuclear localization of another Arp subfamily, Arp6, in vertebrate cells, and show its colocalization with heterochromatin protein 1 orthologs in pericentric heterochromatin. PMID: 16487625

Show More

Hide All

Subcellular Location
Nucleus. Chromosome. Chromosome, centromere.
Database Links

HGNC: 1555

OMIM: 604478

KEGG: hsa:23468

STRING: 9606.ENSP00000209875

UniGene: Hs.349283

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*