Recombinant Human Eukaryotic translation initiation factor 3 subunit E(EIF3E)

Code CSB-EP007534HU
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names EIF3E
Uniprot No. P60228
Research Area Epigenetics and Nuclear Signaling
Alternative Names eIF-3 p48; eIF3e; EIF3E_HUMAN; EIF3S6; eIFe; Eukaryotic translation initiation factor 3 subunit 6; Eukaryotic translation initiation factor 3 subunit E; eukaryotic translation initiation factor 3; subunit 6 (48kD); INT6; mammary tumor-associated protein INT6; murine mammary tumor integration site 6 (oncogene homolog); Viral integration site protein INT-6 homolog
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-445aa
Target Protein Sequence MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 79.1kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis
Gene References into Functions
  1. These data suggest that eIF3e downregulation may be involved in epithelial-mesenchymal transition in endometriosis, possibly through preferential translation of Snail. PMID: 28438065
  2. A transcript-specific eIF3 complex mediates global translational control of energy metabolism. PMID: 27477275
  3. INT6 protects against breast cancer by showing how it functions in DSB repair, with potential clinical implications for cancer therapy. PMID: 27550454
  4. eIF3e is an angiogenesis suppressor. Silencing of eIF3e promotes blood perfusion recovery after limb ischemia through stabilization of hypoxia-inducible factor 2alpha activity. PMID: 25758454
  5. High eIF3e expression may contribute to tumor progression and predict poor prognosis in colon cancer. PMID: 25400724
  6. Int6/eIF3e is essential for proliferation and survival of human glioblastoma cells. PMID: 24481065
  7. 40S ribosome loading imparts a phosphorylation mark on the cap-binding eIF4F complex that regulates selective mRNA translation and is synchronized by a specific eIF3 subunit PMID: 24736843
  8. Our findings indicate that Int6 act as a hypoxia-independent master switch of angiogenesis in neuronal cells PMID: 22960363
  9. eukaryotic initiation factor 4G (eIF4G) protein binds to eIF3c, -d, and -e to promote mRNA recruitment to the ribosome. PMID: 24092755
  10. novel role of eIF3e/Int6 in the regulation of EMT in breast epithelial cells PMID: 22907435
  11. IL-6 and IL-8 are HIF2alpha controlled cytokines for angiogenesis particularly in endothelial cells. PMID: 23478175
  12. HTLV-1Tax binds both INT6 and UPF1. The analysis of Tax mutants indicated that the Tax-INT6 association is necessary for nonsense-mediated mRNA decay inhibition, and data suggest that Tax sequesters INT6 out of reach from UPF1. PMID: 22553336
  13. INT6 and MIF4GD were observed to colocalize in cytoplasmic foci. It was concluded that INT6, by establishing interactions with MIF4GD and SLBP, plays an important role in translation of poly(A) minus histone mRNAs. PMID: 22532700
  14. findings reveal unexpected and striking connections of INT6 with ATM and BRCA1 PMID: 22508697
  15. Int6 depletion blocks ubiquitin-dependent proteolysis by decreasing both ubiquitin levels and the assembly of functional proteasome machinery, leading to accumulation of oncoproteins, such as SRC3. PMID: 20890303
  16. data suggest that eIF3e has a positive role in breast cancer progression. It regulates the translation, and in some cases abundance, of mRNAs involved in key aspects of cancer cell biology PMID: 20453879
  17. Int-6 protein can bind the three complexes /eIF3, COP9 signalosome and 26S proteasome/, possibly exerting a regulatory activity in both protein translation and degradation PMID: 12220626
  18. EIF3e/INT6 is localized in part to the nucleus, while other eIF3 components are cytoplasmic. Primary human fibroblasts showed reduced nuclear INT6 staining in early S phase. PMID: 15030549
  19. Reducing Int-6 expression by RNA interference in HeLa cells markedly alters mitosis progression and defects in spindle formation, chromosome segregation and cytokinesis are observed. PMID: 15558017
  20. Results suggest that Int6 expression, evaluated by quantitative real-time PCR, may represent a new prognostic factor in patients with stage I non-small cell lung cancers. PMID: 15867213
  21. eIF3e binds to eIF4G during the process of cap-dependent translation initiation PMID: 16766523
  22. INT6 stabilizes chromatin-bound MCM7 and alteration of this effect is associated with replication deficiency. PMID: 17310990
  23. INT6 knockdown by RNA interference strongly inhibits nonsense-mediated messenger RNA decay (NMD), which triggers degradation of mRNAs with premature stop codons. PMID: 17468741

Show More

Hide All

Subcellular Location Cytoplasm, Nucleus, PML body
Protein Families EIF-3 subunit E family
Tissue Specificity Ubiquitously expressed. Expressed at highest levels in appendix, lymph, pancreas, skeletal muscle, spleen and thymus.
Database Links

HGNC: 3277

OMIM: 602210

KEGG: hsa:3646

STRING: 9606.ENSP00000220849

UniGene: Hs.405590

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1