Recombinant Human Gap junction alpha-5 protein (GJA5), partial

In Stock Promotion
Code CSB-EP009448HU1
Abbreviation Recombinant Human GJA5 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
(Connexin-40)(Cx40)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
227-358aa
Target Protein Sequence
YHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.6 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
  1. Atrial Fibrillation (AF)-linked Cx40 mutants impair gap junction and/or hemichannel function, which may predispose the mutant carriers to AF. PMID: 29587382
  2. GJA5 gene rs35594137 polymorphism is significantly associated with sudden cardiac death in the examined group. PMID: 28577096
  3. Missense polymorphism in GJA5 independently associated with increased risk for Complete heart block after surgical repair of Congenital Heart Disease. PMID: 27826129
  4. Cx40 genetic polymorphisms increase atrial fibrillation risk in Uyghur and Han residents of Xinjiang. PMID: 27813566
  5. Cx 40 (rs35594137) was associated with atrial fibrillation; in the Uygur population, Cx 40 (rs35594137) should be considered as an independent risk factor for patients with atrial fibrillation, who might have racial differences in rs35594137 variant frequencies PMID: 26634538
  6. This is a review summarizing atrial fibrillation-linked somatic and germline mutations in the gene encoding Cx40. Multiple impairments were observed in these mutants, including impaired gap junction function by abnormal localization or function, as well as increased hemichannel function. PMID: 24656738
  7. Human atrial myocytes express Cx40 and Cx43. However, in vitro expression study indicates that human Cx40 is not able to dock with Cx43 to form heterotypic gap junction channels. This study designed two Cx40 variants, D55N or P193Q. Both of them were successful in forming functional heterotypic gap junction channels with Cx43. PMID: 26625713
  8. Two polymorphisms in the Cx40 promoter are associated with hypertension and left ventricular hypertrophy preferentially in men. PMID: 25992486
  9. Report interaction between ALK1 signaling and connexin40 in the development of arteriovenous malformations. PMID: 26821948
  10. Reduced Cx40 levels and heterogeneity of its distribution (relative to Cx43) are common in atrial fibrillation. PMID: 25200600
  11. Two atrial fibrillation-linked germline Cx40 mutants, V85I and L221I, were investigated. PMID: 24733048
  12. Degradation of a connexin40 mutant linked to atrial fibrillation is accelerated. PMID: 24973497
  13. These findings provide evidence that the connexin 40 Q49X mutant is capable of impairing gap-junction distribution and function of key atrial connexins, which might play a role in the predisposition to and onset of atrial fibrillation. PMID: 24626989
  14. heterozygous Cx40A96S mice exhibit prolonged episodes of induced atrial fibrillation and severely reduced atrial conduction velocities similar to the corresponding human patient. PMID: 24060583
  15. 4 novel heterozygous GJA5 mutations, p.K107R, p.L223M, p.Q236H and p.I257L, were identified in 4 of 310 unrelated AF patients. PMID: 23292621
  16. the germline familial mutations in Cx40 impair the gap junctions through different mechanisms, which may predispose the mutant carriers to AF. PMID: 23348765
  17. Presence of the Cx40 minor allele (-44 G --> A) results in a uniform down-regulation of right atrial appendage Cx40 protein which was not significantly related to development of post-operative AF. PMID: 22423256
  18. Pro265Ser variant in the carboxyl-terminus of connexin 40 alters GAP junctions and increases risk for tetralogy of Fallot. PMID: 22713807
  19. Genotyping of rs10465885 showed that the patients with early-onset lone AF were more likely to carry the A allele compared with controls (odds ratio = 1.30; P = 0.011). PMID: 23040431
  20. Cx40 coding SNPs are uncommon in atrial fibrillation populations, although rare mutations in this gene may lead to atrial fibrillation pathogenesis. PMID: 23134779
  21. Results implicate GJA5 as the gene responsible for the congenital heart disease phenotypes observed with copy number imbalances at this locus. PMID: 22199024
  22. our study could not detect an association of Cx40 promoter polymorphisms and CAD in human PMID: 22405441
  23. This is the first evidence of intrinsic differences in the Ca2+ regulatory properties of Cx43 and Cx40. PMID: 22422398
  24. Heteromeric cotransfection of Cx40-WT and Cx40-Q58L resulted in homogenous distribution of proteins in the plasma membrane rather than in membrane plaques in approximately 50% of cells; well-defined gap junctions were observed in other cells. PMID: 22247482
  25. Regulation of endothelial connexin40 expression by shear stress via PI3K/Akt pathway. PMID: 22021330
  26. Association between hereditary sick sinus node syndrome and connexin 40 gene polymorphism was demonstrated. PMID: 21649591
  27. There is an alternate promoter polymorphism that directly affects levels of Cx40 mRNA in vivo and is associated with early-onset lone atrial fibrillation. PMID: 21076161
  28. Three novel connexin40 mutations (p.V85I, p.L221I, and p.L229M) were identified which co-segregated with atrial fibrillation and were absent in the controls without atrial fibrillation. PMID: 20650941
  29. In patients with cerebral ischemic events, without prior CVD, a higher prevalence of the Cx40 gene polymorphism, as a marker of underlying idiopathic atrial fibrillation appeared to be absent. PMID: 19494781
  30. Data suggest that these dynamic changes of connexins 43, 40 and 45 during mouse cardiac development appear to be mirrored in the human. PMID: 12064615
  31. Our data show that the presence of Cx40 does not allow GJIC and is associated with the extravillous phenotype PMID: 12397213
  32. endothelial gap junction protein connexin 37 and connexin 40-mediated communication in the development and/or functional maintenance of segments of the mouse vasculature. PMID: 12435353
  33. 505 CHD cases were screened for the Cx40 gene to see if altered copy number associated with a cardiac phenotype. 3 cases carred deletions on chromosome 1q21.1 spanning ACPL1, Cx40, and Cx50 genes, with aortic arch anomalies being a particular feature. PMID: 15117819
  34. The -44A allele & -44AA genotype were significantly more frequent in subjects with prior AF than in those without, providing strong evidence linking Cx40 polymorphisms to enhanced atrial vulnerability and increased risk of AF. PMID: 15297374
  35. Coinheritance of Cx40 polymorphisms is a possible genetic factor that modifies the clinical manifestation of this inherited arrhythmia. PMID: 16188595
  36. We conclude that decidual secretion of growth factors, such as EGF, may act to prime trophoblast for migration/invasion through modulation of connexin expression and function. PMID: 16545451
  37. there may be more than one conformation form of the connexin40 carboxyl tail with roles in atrial conduction and arrhythmogenesis PMID: 16600287
  38. Cx40 polymorphisms are associated with enhanced spacial dispersion of refractoriness and thus with susceptibility to reentry and atrial fibrillation PMID: 16646598
  39. Four novel heterozygous missense mutations were identified in 4 of the 15 patients. Mutations in GJA5 may predispose patients to idiopathic atrial fibrillation by impairing gap-junction assembly or electrical coupling. PMID: 16790700
  40. The two SNPs in the promoter region of the Cx40 gene were significantly associated with atrial fibrillation and the Cx40 (-44A +71G) haplotype was associated with a higher risk for atrial fibrillation. PMID: 16814413
  41. a cross-talk between CFTR and a variety of gap junction channels. Cytoskeletal scaffolding proteins and/or other intermediate cytoplasmic proteins are likely to play a role in CFTR-connexins interaction. PMID: 17546509

Show More

Hide All

Involvement in disease
Atrial standstill 1 (ATRST1); Atrial fibrillation, familial, 11 (ATFB11)
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Database Links

HGNC: 4279

OMIM: 108770

KEGG: hsa:2702

STRING: 9606.ENSP00000271348

UniGene: Hs.447968

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*