Recombinant Human Immunity-related GTPase family M protein (IRGM)

Code CSB-EP011827HU
Abbreviation Recombinant Human IRGM protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
IRGM
Uniprot No.
Research Area
Immunology
Alternative Names
IFI1; Iigp3; Iipg3; Immunity related GTPase family M protein 1; Immunity related GTPase family, M; Immunity-related GTPase family M protein 1; Immunity-related GTPase family M protein; Interferon inducible protein 1; Interferon-inducible protein 1; Irgm; IRGM_HUMAN; IRGM1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; LRG 47; LRG-47; LRG-47-like protein; LRG47; MGC149263; MGC149264
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-181aa
Target Protein Sequence
MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.1kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility.
Gene References into Functions
  1. Findings suggest that ATP/GTP binding protein like 2 (AGBL2) plays a critical oncogenic role in the pathogenesis of hepatocellular carcinoma (HCC) through modulation on immunity-related GTPase family, M protein (IRGM)-regulated autophagy and aurora kinase A (Aurora A) activity. PMID: 29126912
  2. The association of ATG16L1 to Crohn's disease in Iranian patients was confirmed while it was shown that the studied polymorphisms in IRGM was not associated with Crohn's disease. PMID: 29960072
  3. Four haplotypes showed a frequency of > 1%, among which the haplotype C-T-A-T-G was significantly associated with chronic periodontitis PMID: 28983640
  4. HCV triggers IRGM-mediated phosphorylation of the early autophagy initiator ULK1, thereby providing mechanistic insight into the role of IRGM in HCV-mediated autophagy. PMID: 28389568
  5. Irgm1/IRGM participates in the polarization of M1 macrophages, is upregulated in human atheromata, and promotes development of atheroma in murine experimental atherosclerosis PMID: 27439214
  6. The results confirmed that polymorphisms in NOD2 (Leu1007insC) and IRGM genes are associated with increased risk of Crohn's disease; whereas the ORMDL3 variant is associated with susceptibility to ulcerative colitis in the Lithuanian early-onset inflammatory bowel disease population. PMID: 27932194
  7. IRGM rs10065172 was associated with decreased risk of tuberculosis in Asian populations, but not in African/Africa-Americans. rs4958842, rs4859843, and rs4859846, had a large protective effect in Asians, whereas rs72553867 was not associated with tuberculosis risk. PMID: 29068986
  8. Polymorphisms of IRGM gene is associated with susceptibility to ankylosing spondylitis. PMID: 28031552
  9. IRGM polymorphism differences between latent and active TB suggests that genetic differences in autophagy might partly affect host TB infection status. PMID: 26980495
  10. IRGM functional polymorphisms and haplotypes in promoter were associated with the susceptibility to pulmonary tuberculosis in Chinese Hubei Han population. PMID: 26786655
  11. In Korean children, IRGM rs1000113 and IRGM rs72553867 exhibited associations with early-onset Crohn Disease as risk loci and defense loci, respectively. PMID: 25944217
  12. The study confirms IRGM rs13361189 and rs4958847 polymorphisms to be important for Crohn's disease susceptibility and phenotype modulation, in accordance with previous findings. PMID: 26066377
  13. Expression of viral protein 2C enhanced IRGM promoter activation, thereby increasing IRGM expression and inducing autophagy. PMID: 25853521
  14. these data reveal an Irgm1-dependent mechanism that promotes the tumorigenesis of melanoma via dual regulation of apoptosis and Bif-1-dependent autophagy PMID: 25619828
  15. the IRGM(+313), an autophagy-related polymorphic locus, influences outcome in severely septic patients, with the possible involvement of autophagy in sepsis exacerbation PMID: 24626347
  16. Results show association of IRGM gene SNPs with Crohn's disease in Indian patients and report a new mutation rs 9637876 in the IRGM gene associated with Crohn's disease. PMID: 25191865
  17. Our findings suggest that expression of IRGM is dysregulated in gastric cancer and that the molecule may affect progression of the disease. PMID: 25707354
  18. The IRGM rs13361189 polymorphism is promising as a biomarker for early diagnosis of Crohn's disease. However, the IRGM rs10065172 and rs4958847 polymorphisms may not be the major determinants of Crohn's disease risk. PMID: 25526194
  19. Data indicate that immunity-related GTPase family M (IRGM) plays a direct role in organizing the core autophagy machinery to endow it with antimicrobial and anti-inflammatory functions. PMID: 25891078
  20. RGM directly organizes the core autophagy machinery and links it with antimicrobial and anti-inflammatory functions. IRGM interacts with ULK1 and Beclin 1 promoting their co-assembly into autophagy initiation complexes. All three Crohn's disease risk factors, IRGM, NOD2 and ATG16L1, form a complex. NOD2 enhances K63-polyubiquitination of IRGM, promoting IRGM assembly with core autophagy regulators. PMID: 25891078
  21. IRGM assembles core autophagy machinery (Beclin 1, Ulk1, ATG16L1) and connects it with innate immunity sensors (NOD2) through formation of protein complex assemblies. PMID: 25891078
  22. This is the first study to identify a significant association between the IRGM single-nucleotide polymorphism (SNP) rs10065172 and susceptibility to active tuberculosis disease in an Asian population. PMID: 24595493
  23. IRGM expression is upregulated in monocytes and monocyte-derived macrophages by Mycobacterium leprae PMID: 24469081
  24. the presence of the IRGM1 rs13361189 variant allele was associated with a lower use of immunosuppressant therapy, high-lighting a possible role in the development of a milder phenotype. PMID: 24656308
  25. a potential role of IRGM in the development of glioma probably by affecting IFN-gamma and IL-4. PMID: 24859836
  26. Despite moderate effects on the modulation of proinflammatory cytokine production, genetic variation in the autophagy genes ATG16L1 and IRGM has a minor impact on the susceptibility to both mucosal and systemic Candida infections. PMID: 24713404
  27. IRGM gene polymorphism is associated with the increased risk of leprosy by affecting inflammatory cytokines. PMID: 24264476
  28. These results indicated that autophagy gene-IRGM polymorphisms appear to confer susceptibility to CD but not UC, especially in Europeans. PMID: 24232856
  29. IRGM single nucleotide polymorphisms are associated with Crohn's disease. PMID: 22508677
  30. In a Portuguese population, SNPs at three autophagy-related genes, ATG16L1, IRGM, and ITLN1, contribute to predict Crohn's ileal or ileocolonic disease, involvement of the upper digestive tract, and response to treatment. PMID: 22573572
  31. IRGM is a susceptibility gene for Crohn's disease in the German population. PMID: 23365659
  32. IRGM polymorphisms are associated with decreased susceptibility to pulmonary tuberculosis. PMID: 23049477
  33. IRGM rs4958847 polymorphism influences susceptibility to gastric cancer, mainly for the intestinal type. PMID: 22713085
  34. Variants in the genes ATG16L1 and IRGM affect autophagy and are associated with the development of Crohn's disease PMID: 22370477
  35. IFN-gamma enhances Con A-induced autophagic flux and causes an IRGM1-dependent lysosome-mediated necrotic cell death in hepatocytes PMID: 22163006
  36. Irgm3 relieves the ER stress response via a PI3K/Akt dependent mechanism, which contributes to host defence against coxsackievirus B3 infection. PMID: 21981022
  37. Our work reveals an unexpected role of IRGM in virus-induced autophagy PMID: 22174682
  38. Single-nucleotide polymorphism rs4958847 in the IRGM gene correlated very significantly with frequency of surgery in patients with ileocolonic Crohn's disease. PMID: 22228152
  39. a critical "menage a trois" in risk susceptibility to Crohn disease combining IRGM allele, miRNA and xenophagy PMID: 21508684
  40. this Crohn's Disease-related IRGM1 polymorphic allele is also associated with human susceptibility to tuberculosis disease among African Americans PMID: 21283700
  41. Data show that an additive gene-gene interaction involving TLR4, PSMG1, TNFRSF6B and IRGM was identified with CD. PMID: 21079743
  42. the unusual evolutionary history of the IRGM locus and the important role of the IRGM gene in autophagy and Crohn's disease in response to pathogenesis. PMID: 20737271
  43. Data suggest that NKX2-3 and IRGM are susceptibility loci for inflammatory bowel disease in Eastern European patients. PMID: 21049557
  44. In 1.7 kb IRGM promoter region, only -1208A/G polymorphism is associated with susceptibility to TB PMID: 20547146
  45. IRGM demonstrated differential affinity for the mitochondrial lipid cardiolipin, translocated to mitochondria, affected mitochondrial fission and induced autophagy. PMID: 21102437
  46. Observational study of gene-disease association. (HuGE Navigator) PMID: 19760754
  47. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20886065
  48. Observational study of gene-disease association. (HuGE Navigator) PMID: 20962850
  49. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 21049557
  50. Observational study of gene-disease association. (HuGE Navigator) PMID: 21072187

Show More

Hide All

Involvement in disease
Inflammatory bowel disease 19 (IBD19)
Subcellular Location
Golgi apparatus membrane. Cell membrane. Cytoplasmic vesicle, phagosome membrane. Cytoplasmic vesicle, autophagosome membrane. Cell projection, phagocytic cup.
Protein Families
TRAFAC class dynamin-like GTPase superfamily, IRG family
Tissue Specificity
Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes.
Database Links

HGNC: 29597

OMIM: 608212

KEGG: hsa:345611

STRING: 9606.ENSP00000428220

UniGene: Hs.519680

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*