Recombinant Human Immunity-related GTPase family M protein(IRGM)

Code CSB-EP011827HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. A1A4Y4
Relevance Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Immunity-related GTPase family M protein 1Interferon-inducible protein 1LPS-stimulated RAW 264.7 macrophage protein 47 homolog
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
Research Area Immunology
Source E.coli
Gene Names IRGM
Protein Names Recommended name: Immunity-related GTPase family M protein EC= 3.6.5.-Alternative name(s): Immunity-related GTPase family M protein 1 Interferon-inducible protein 1 LPS-stimulated RAW 264.7 macrophage protein 47 homolog Short n
Expression Region 1-181aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility (By similarity).
Involvement in disease Inflammatory bowel disease 19 (IBD19)
Subcellular Location Golgi apparatus membrane, Cell membrane, Cytoplasmic vesicle, phagosome membrane, Cytoplasmic vesicle, autophagosome membrane, Cell projection, phagocytic cup
Protein Families TRAFAC class dynamin-like GTPase superfamily, IRG family
Tissue Specificity Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes.
Database Links

HGNC: 29597

OMIM: 608212

KEGG: hsa:345611

STRING: 9606.ENSP00000428220

UniGene: Hs.519680

Related Products

IRGM Antibodies

IRGM Antibodies for Human

IRGM Antibodies for Homo sapiens (Human)

IRGM Proteins

IRGM Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.