Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP013096HU |
| Product Type | Recombinant Protein |
| Size | US$2010 |
| Uniprot No. | P98164 |
| Relevance | Acts together with cubilin to mediate HDL endocytosis . May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Glycoprotein 330 ;gp330Megalin |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE |
| Research Area | Immunology |
| Source | Yeast |
| Gene Names | LRP2 |
| Protein Names | Recommended name: Low-density lipoprotein receptor-related protein 2 Short name= LRP-2 Alternative name(s): Glycoprotein 330 Short name= gp330 Megalin |
| Expression Region | 1186-1389aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 24.2kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Multiligand endocytic receptor (By similarity). Acts together with CUBN to mediate endocytosis of high-density lipoproteins (By similarity). Mediates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides and polymyxin B (By similarity). In the kidney, mediates the tubular uptake and clearance of leptin (By similarity). Also mediates transport of leptin across the blood-brain barrier through endocytosis at the choroid plexus epithelium (By similarity). Endocytosis of leptin in neuronal cells is required for hypothalamic leptin signaling and leptin-mediated regulation of feeding and body weight (By similarity). Mediates endocytosis and subsequent lysosomal degradation of CST3 in kidney proximal tubule cells (By similarity). Mediates renal uptake of 25-hydroxyvitamin D3 in complex with the vitamin D3 transporter GC/DBP (By similarity). Mediates renal uptake of metallothionein-bound heavy metals |
| Involvement in disease | Donnai-Barrow syndrome (DBS) |
| Subcellular Location | Apical cell membrane, Single-pass type I membrane protein, Endosome lumen, Membrane, coated pit, Cell projection, dendrite, Cell projection, axon |
| Protein Families | LDLR family |
| Tissue Specificity | Expressed in first and third trimester cytotrophoblasts in the placenta (at protein level) (PubMed:27798286). Absorptive epithelia, including renal proximal tubules. |
| Database Links |
HGNC: 6694 OMIM: 222448 KEGG: hsa:4036 STRING: 9606.ENSP00000263816 UniGene: Hs.657729 |
| Pathway |
Hedgehog signaling pathway
Th17 cell differentiation Thyroid hormone synthesis Cholesterol metabolism |
LRP2 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA013096GA01HU | LRP2 Antibody | Human | ELISA,WB |
| CSB-PA284465 | LRP2 Antibody | Human,Mouse,Rat | ELISA,IHC |
| CSB-PA087523 | LRP2 Antibody | Human,Mouse,Rat | ELISA,IHC |
| CSB-PA009078LB01HU | LRP2 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA009078LC01HU | LRP2 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA009078LD01HU | LRP2 Antibody, Biotin conjugated | Human | ELISA |
LRP2 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA009078LA01HU | LRP2 Antibody | Human | ELISA, IHC, IF |
| CSB-PA013096LA01HU | LRP2 Antibody | Human | ELISA, IHC |
| CSB-PA013096LB01HU | LRP2 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA013096LC01HU | LRP2 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA013096LD01HU | LRP2 Antibody, Biotin conjugated | Human | ELISA |
LRP2 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP013096HU CSB-BP013096HU CSB-MP013096HU |
Recombinant Human Low-density lipoprotein receptor-related protein 2(LRP2) ,partial | E.coli Baculovirus Mammalian cell |
Recombinant Human Ras-related protein Rab-5C(RAB5C)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Pyridoxal phosphate phosphatase(Pdxp)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Nuclear transport factor 2(NUTF2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Ras-related protein Rab-10(Rab10)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Ras-related protein Rap-2b(RAP2B)
Express system: E.coli
Species: Homo sapiens (Human)
