Recombinant Human Low-density lipoprotein receptor-related protein 2(LRP2),partial

Code CSB-YP013096HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P98164
Relevance Acts together with cubilin to mediate HDL endocytosis . May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Glycoprotein 330 ;gp330Megalin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE
Research Area Immunology
Source Yeast
Gene Names LRP2
Protein Names Recommended name: Low-density lipoprotein receptor-related protein 2 Short name= LRP-2 Alternative name(s): Glycoprotein 330 Short name= gp330 Megalin
Expression Region 1186-1389aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 24.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Multiligand endocytic receptor (By similarity). Acts together with CUBN to mediate endocytosis of high-density lipoproteins (By similarity). Mediates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides and polymyxin B (By similarity). In the kidney, mediates the tubular uptake and clearance of leptin (By similarity). Also mediates transport of leptin across the blood-brain barrier through endocytosis at the choroid plexus epithelium (By similarity). Endocytosis of leptin in neuronal cells is required for hypothalamic leptin signaling and leptin-mediated regulation of feeding and body weight (By similarity). Mediates endocytosis and subsequent lysosomal degradation of CST3 in kidney proximal tubule cells (By similarity). Mediates renal uptake of 25-hydroxyvitamin D3 in complex with the vitamin D3 transporter GC/DBP (By similarity). Mediates renal uptake of metallothionein-bound heavy metals
Involvement in disease Donnai-Barrow syndrome (DBS)
Subcellular Location Apical cell membrane, Single-pass type I membrane protein, Endosome lumen, Membrane, coated pit, Cell projection, dendrite, Cell projection, axon
Protein Families LDLR family
Tissue Specificity Expressed in first and third trimester cytotrophoblasts in the placenta (at protein level) (PubMed:27798286). Absorptive epithelia, including renal proximal tubules.
Database Links

HGNC: 6694

OMIM: 222448

KEGG: hsa:4036

STRING: 9606.ENSP00000263816

UniGene: Hs.657729

Pathway Hedgehog signaling pathway
Th17 cell differentiation
Thyroid hormone synthesis
Cholesterol metabolism

Related Products

LRP2 Antibodies

LRP2 Antibodies for Homo sapiens (Human)

LRP2 Antibodies for Human

LRP2 Proteins

LRP2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.