Recombinant Human Mannose-binding protein C(MBL2)

Code CSB-YP013540HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names MBL2
Uniprot No. P11226
Research Area Immunology
Alternative Names COLEC 1; COLEC1; Collectin-1; HSMBPC; Lectin; mannose-binding; soluble; 2; Mannan binding lectin; Mannan binding protein; Mannan-binding protein; Mannose binding lectin (protein C) 2 soluble; Mannose binding lectin (protein C) 2; soluble (opsonic defect); Mannose binding lectin (protein C) 2; soluble; Mannose binding lectin 2 soluble; Mannose binding lectin 2; soluble (opsonic defect); Mannose binding lectin; Mannose binding lectin protein C2 soluble opsonic defect; Mannose binding protein; Mannose binding protein C; Mannose binding protein C precursor ; Mannose binding protein; serum; Mannose-binding lectin; Mannose-binding protein C; MBL 2; MBL; MBL2; MBL2_HUMAN; MBL2D; MBP 1; MBP; MBP C; MBP-C; MBP1; MBPB; MBPC; MBPD; MGC116832; MGC116833; Opsonic defect; protein C; Soluble mannose binding lectin
Species Homo sapiens (Human)
Source Yeast
Expression Region 21-248aa
Target Protein Sequence ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 26.0kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
Gene References into Functions
  1. These findings suggest that high activity of the classical complement pathway, and MBL deficiency, might be associated with an increased odds of unprovoked venous thromboembolism, independent of activation of Tissue Factor-induced coagulation. PMID: 30015228
  2. he carrying of MBL2 exon 1 codon 54 variant allele (B) was shown to be a risk factor for Recurrent vulvovaginal candidiasis in childbearing women. PMID: 29850562
  3. Positive correlation of MBL levels with anti-ds DNA titers in systemic lupus erythematosus suggest that its values vary with activity and could be a potential biomarker of the disease. PMID: 29314753
  4. The -221G>C polymorphism of MBL2, the -159C>T polymorphism of CD14 and the TNF-857 polymorphism of TNF-a are risk factors for spinal spinal tuberculosis (TB) and may be involved in the development of spinal TB in the Chinese population. These factors are indicators of susceptibility to spinal TB and require clinical attention. PMID: 29298876
  5. MBL2 protein blood level was significantly reduced in the hepatocellular carcinoma patients.The association in MBL2 polymorphisms and the risk of hepatocellular carcinoma. PMID: 27557564
  6. Results suggested the involvement of MBL2 (rs1800450) polymorphism and its protein in rheumatic heart disease pathogenesis. PMID: 29653582
  7. MBL deficiency was significantly more frequent in the juvenile idiopathic arthritis Yersinia-reactive antibodies-positive group than in patients without Yersinia-reactive antibodies or in controls PMID: 28405017
  8. it can be concluded that molecular analysis of MBL rs1800450 AA genotype and TNF-alpha rs1800620 AA genotype is important in the early detection and treatment of T2DM with H. pylori cagA(+) infection. PMID: 29053425
  9. The results suggest that MBL deficiency and the presence of MBL2 gene polymorphisms that lead to MBL deficiency are risk factors for the occurrence of miscarriage in patients with RA. PMID: 28898115
  10. These results suggest that the MBL2 gene Codon 54 and TNF-alpha gene G308A polymorphisms are not associated with an increased risk for development of tuberculosis in our patients. PMID: 28189510
  11. Studies results provide evidence that Crohn's disease patients have an impairment in mannose-binding lectin-mannose-associated serine protease functional activity and that this defect is associated with mannose-binding lectin 2 and NOD2 variants. PMID: 27404661
  12. Our data do not support a possible role for MBL2 polymorphisms in the pathogenesis and in the clinical manifestations of rheumatic fever. PMID: 28576308
  13. The reduced expression of functional MBL secondary to having MBL2 variants may partially mediate the increased susceptibility to TB risk. PMID: 27812036
  14. MBL2 rs1800450 and rs1800451 polymorphisms play a protective role in TB infection and reinforce their critical significance as a potential genetic marker for TB resistance. PMID: 27876780
  15. genetic variants facilitate extended periodontal inflammation and destruction by Aggregatibacter actinomycetemcomitans PMID: 27624657
  16. MBL2 exon 1 polymorphic variants were found only in codon 54, and the allele frequencies did not differ significantly between the control and disease groups PMID: 28558668
  17. These results indicated that polymorphisms in MBL2 gene may influence susceptibility, progression and prognosis of HBV-related liver diseases. PMID: 26857650
  18. The article data indicate that rs11003125 in the MBL2 (Mannose Binding Lectin 2) gene was shown to be associated with a high prevalence of caries in our cohort, and 2 haplotypes are also involved in the increased susceptibility to dental caries. PMID: 27894112
  19. the findings of the current study obtained on mother and children from Zambia evidence lack of association between MBL2 functional polymorphisms and HIV-1 mother-to-child transmission PMID: 26740328
  20. Mannose-binding lectin levels are largely genetically determined. This relationship was preserved in children during critical illness, despite the effect of large-volume fluid administration on mannose-binding lectin levels. Mannose-binding lectin levels had no association with infection status at admission, or with progression from systemic inflammatory response syndrome to sepsis or septic shock. PMID: 27820718
  21. Low MBL levels are associated with a higher risk for future cardiac events and cardiovascular events. PMID: 27495980
  22. results showed that despite MBL2 gene polymorphisms being associated with the protein plasma levels, the polymorphisms were not enough to predict the development of heart disease, regardless of infection with both species of Chlamydia. PMID: 27982280
  23. MBL2 polymorphisms are associated with higher incidence of development of coronary in-stent restenosis. PMID: 28056798
  24. MBL2 gene exon1 polymorphisms are associated with increased risk of high-risk HPV infection and cervical cancer development among Caucasians (Meta-Analysis) PMID: 27619685
  25. these data support the concept that rhMBL may serve a protective innate host response and a critical biological response modifier function by limiting AM inflammation, oxidative injury, and AM apoptosis, which may allow effective IAV clearance while limiting collateral damage to vital organs, such as the lungs. PMID: 24399838
  26. In a large cohort of VLBWI MBL2 deficiency had no major impact on infection risk unless children were born between 32 0/7 and 36 6/7 weeks of gestation PMID: 28558032
  27. The results suggest that the mutations in exon 1 of the MBL2 gene do not contribute directly to the clinical and laboratory features of HCV and HBV infections, but further studies should be performed to confirm whether the wild AA genotype has indirect effect on disease progression. PMID: 28408790
  28. binding of dengue virus NS1 to MBL protects dengue virus against mannose-binding lectin-mediated neutralization by the lectin pathway of complement activation PMID: 27798151
  29. study provides evidence for an important role for the lectin pathway in the inflammatory response induced by cholesterol crystals (CC) and emphasize the role of ficolin-2 and MBL in the CC-mediated inflammation occurring during atherosclerotic plaque development PMID: 27183610
  30. In our meta-analysis, no significant association was found between MBL2 codon 54 A/B, -550 H/L, or -221 X/Y gene polymorphisms and the risk of asthma under 5 genetic models PMID: 27590640
  31. MBL2 genotype association with meningococcal disease was not statistically significant. PMID: 27351742
  32. The SNP genotypes of MBL2 influence the plasma levels of MBL. However, there is a wide range in MBL levels for a specific genotype of MBL2 during pregnancy indicating that a low second-trimester plasma MBL level is not a marker for the development of preterm birth. PMID: 27124763
  33. We have identified two single-nucleotide polymorphisms in two immune-related genes (MBL2 and CD95) that have an association with severe and potentially life-threatening infection following doxorubicin and cyclophosphamide therapy for breast cancer. PMID: 27940354
  34. this study shows that collectin may aid clearance of influenza A virus by promoting monocyte uptake of the virus, while reducing viral replication and virus-induced TNF-a responses in these cells PMID: 27856789
  35. findings suggest that complement activation mediated by MBL contributes to the pathogenesis and also severity of Multiple sclerosis, Myasthenia gravis, and Guillain-Barre Syndrome . PMID: 27424141
  36. Studied the relationship between polymorphisms in MBL, TLR1, TLR2 and TLR6 encoding genes and stimulated IFN-gamma and IL-12 ex vivo production in BCG osteitis survivors. Found that variant genotypes of the MBL2 gene (if homozygous) and variant genotypes of the TLR2 gene (only heterozygotes present) are associated with low IFN-gamma production. PMID: 27755461
  37. this study shows that MBL2 polymorphisms is not a major risk factor for community-acquired pneumonia in general, but patients with genotypes corresponding with high serum MBL levels are at risk for atypical pneumonia PMID: 28032346
  38. MBL-deficient individuals with additional lectin pathway pattern recognition molecular defects may be at risk to morbidity. PMID: 26795763
  39. MBL2 polymorphisms were associated with an increased and TLR7 polymorphisms with a decreased risk of rhinovirus-associated acute otitis media. PMID: 28403045
  40. MBL2 rs11003123 polymorphism may be a marker for the risk of hepatocellular carcinoma occurrence in patients with HBV-related cirrhosis in the Chinese population. PMID: 27298104
  41. this study shows that MBL levels may be linked with the occurrence of spondyloarthritis in Brazilian patients PMID: 27911110
  42. Low baseline MBL levels were correlated with high risk of gram-negative bacteremia; however, no significant correlation was shown in the follow-up. PMID: 26377840
  43. These results indicate that the mycobacterial antigen 85 complex is a target for ficolins and mannose-binding lectin. PMID: 27141819
  44. In type 1 diabetic patient, evaluated serum levels of MBL can be seen as an independent marker of diabetic nephropathy even after correcting for possible confounding factors. PMID: 26212019
  45. association between C + 4T (P/Q) gene polymorphism and oropharyngeal tularemia PMID: 27223255
  46. this study shoes that Brazilian patients carrying genotypes or haplotypes of low production of MBL would be more susceptible to dengue haemorrhagic fever PMID: 27180198
  47. Low MBL serum levels and deficient MBL2 diplotypes were associated with a higher incidence of acute cellular rejection during the first year after kidney transplantation. PMID: 26924055
  48. this study shows the role of MBL2 polymorphisms in hepatitis C infection susceptibility in Italy PMID: 27136459
  49. Preterm infants who had low levels of MBL at admission are exposed to an increased risk of adverse neurological outcomes. PMID: 26153116
  50. Variant A allele in MBL2 gene rs1800450 polymorphism might increase the risk of sepsis via decrease the MBL serum level PMID: 26823854
  51. Polymorphisms of the MBL2 gene is associated with fever episodes in pediatric cancer. PMID: 26433879
  52. MBL2 and MASP2 deficiencies protect against the development of systemic inflammatory response after pediatric cardiac surgery. PMID: 26382056
  53. Human and murine data together indicate that SP-A, SP-D and MBL are synthesized in early gestational tissues, and may contribute to regulation of immune response at the feto-maternal interface during pregnancy. PMID: 26603976
  54. Our meta-analysis of accessible, published data has demonstrated no statistically significant association between MBL2 genotype and recurrent respiratory tract infection in children. PMID: 26810288
  55. No remarkable associations were detected regarding codon 52, 57, exon 1 and extended genotype of MBL2 with the risk rheumatoid arthritis. Meta-analysis. PMID: 25350077
  56. Frequent IgG subclass and mannose binding lectin deficiency has been found in patients with chronic fatigue syndrome. PMID: 26429318
  57. In type 2 diabetic patients with stroke, high levels of MBL predict future functional outcomes and mortality. This indicated that the elevated MBL levels may play a significant role in the pathology of the subsequent damage. PMID: 25341475
  58. MBL2 functional variants were associated with Visceral Leishmaniasis. PMID: 26297290
  59. MBL2 haplotype is associated with frequent exacerbations and high serum MBL is linked to increased survival in COPD patients. PMID: 26684757
  60. MBL gene codon 54 variant allele B is related to low serum MBL levels, increased IL-6 levels, genitourinary infections and may cause pregnancy-related problems such as infertility, recurrent miscarriage and preterm delivery PMID: 26613217
  61. Results suggests that MBL-2 plays a role as a disease modifier in primary ciliary dyskinesia, but only by aggravating the severity of bronchiectasis PMID: 24753481
  62. FCN2 and MBL2 allele frequencies were similarly distributed in early and late age-related macular degeneration cases compared with controls PMID: 26207622
  63. The results of the meta-analysis evidenced that MBL2 low producing OO and XX genotypes do not confer higher risk to rheumatoid arthritis PMID: 26608926
  64. Mannose binding protein polymorphism is involved in the progression of chronic hepatitis C in children. PMID: 25956563
  65. These findings suggest a protective effect of genetically determined MBL2 deficiency against the development and progression of chronic Chagas cardiomyopathy. PMID: 26745156
  66. Mannose-binding lectin expression was documented after traumatic brain injury. The reduced sequelae associated with mannose-binding lectin absence suggest that mannose-binding lectin modulation might be a potential target after traumatic brain injury. PMID: 24810526
  67. MBL is a novel, independent diagnostic marker of diabetic retinopathy in type 2 diabetic patients, suggesting that MBL may be involved in the pathogenesis of diabetic retinopathy in diabetic patients. PMID: 26136138
  68. polymorphism of MBL (rs7096206) gene was associated with susceptibility to tuberculosis. PMID: 25312983
  69. Functional variations in MBL2 gene are associated with cutaneous leishmaniasis caused by Leishmania guyanensis in the Amazonas state of Brazil. PMID: 25764115
  70. The CCL2 G-2518A and MBL codon 54 variant have a significantly cumulative effect on increased risk of severe acute respiratory syndrome coronavirus infection. PMID: 25818534
  71. MBL may be involved in the pathogenesis of diabetic nephropathy in type 2 diabetes. PMID: 25803807
  72. The aim of the present study was to investigate the role of MBL and its association with susceptibility and clinical expression of SLE through the analysis of promoter region and exonic polymorphism of MBL2 gene PMID: 25900955
  73. Lower plasma MBL levels are protective against both S. haematobium and S. mansoni infections and MBL2 promoter and variants LY and LL increase susceptibility to S. haematobium infection. PMID: 25830474
  74. Studied 4 important MBL2 SNPs in 1839 European community-acquired pneumonia and peritonitis sepsis cases, and 477 controls from the United Kingdom; no associations between MBL2 genotype and sepsis susceptibility or outcome were identified. PMID: 25969530
  75. neonates with MBL deficiency and low MBL serum levels at birth may be at higher risk of developing severe respiratory complications. PMID: 25879044
  76. The hepatitis B patients who are homozygous for codon 54 of MBL are prone to develop chronic infection. Longitudinal studies with larger groups are needed. PMID: 25843194
  77. The presence of a variant genotype of the MBL2 gene (and the correspondingly lower serum concentration of this molecule) was not correlated with the development of carotid restenosis after CEA. PMID: 25725598
  78. Polymorphisms of mannose-binding lectin (rs7096206) and MASP-2 (rs2273346 and rs6695096) were associated with the susceptibility of tuberculosis, and there were gene-gene interactions among them. PMID: 25887173
  79. These results suggest a possible involvement of MBL2 functional polymorphisms in atypical squamous cells of undetermined significance susceptibility. PMID: 25693844
  80. YB haplotype is associated with low serum levels of mannose-binding lectin (MBL). There was no association between MBL2 gene polymorphisms and susceptibility to dengue infection but the frequency of YB was higher in patients than in controls. PMID: 26506729
  81. In this meta-analysis, there was an involvement of serum mannose-binding lectin levels in sepsis patients, with lower levels compared to controls. PMID: 25323207
  82. MBL2 gene as a modulating factor in cystic fibrosis determining the progression of the disease. PMID: 25178872
  83. This systematic review and meta-analysis were performed to assess the association between MBL2 codon 54 genotype and vulvovaginal candidiasis (VVC) or recurrent VVC. PMID: 25143944
  84. Preterm infants who are carriers of MBL2 exon-1 OO genotype are exposed to an increased risk of adverse neurological outcomes. PMID: 25119337
  85. Serum MBL levels are a useful, complementary tool to predict functional outcome and mortality 90 days after stroke. PMID: 24691546
  86. the polymorphism G54D of the gene MBL2 had no effect in the need for additional treatment associated with the diet-based therapy and in the occurrence of large newborns for gestational age in the studied population. PMID: 25627044
  87. Our findings suggest that low MBL levels do not increase the susceptibility for HCV infection. Furthermore, mannose-binding lectin levels were not found to have a significant effect on the course of the disease or treatment response PMID: 25599785
  88. These findings suggest that decreased serum MBL levels due to polymorphisms of the MBL2 gene may increase susceptibility to the development of DI-OA in DI-exposed individuals. PMID: 25857450
  89. The findings suggest that MBL2 supports innate immune defence against meningococcal disease in the early months of life, before acquired immunity is sufficiently robust for effective natural protection PMID: 24977653
  90. We show the pulmonary macrophage dysfunction in COPD may at least partially result from an oxidative stress-induced effect on MBL, and identify a further potential therapeutic strategy for this debilitating disease. PMID: 24901869
  91. study has examined promoter and exon 1 of mbl2 genotype among 117 Iranian healthy blood donors PMID: 25148801
  92. Our findings suggest that the MBL2 polymorphism rs7096206 is associated with hepatocellular carcinoma susceptibility and has the potential to serve as a biomarker to detect populations at increased hepatocellular carcinoma risk PMID: 25787238
  93. Findings suggest an association of genetically determined low MBL production and invasive pneumococcal disease in younger children. PMID: 24602163
  94. Data indicate that mannose-binding lectin (MBL) deficiency was not associated with an altered inflammatory profile in blood donors PMID: 25167768
  95. Serum MBL did not differentiate between CDI cases and AAD controls, but among CDI cases, MBL concentration, but not genotype, was associated with CDI recurrence, indicating that MBL acts as a modulator of disease, rather than a predisposing factor. PMID: 25170052
  96. The high prevalence of the MBL2 LYPB variant causing low levels of functional MBL in serum may mainly reflect a random distribution due to a population bottleneck in the founder populations. PMID: 25313559
  97. IL-6 G/G and MBL AA gene polymorphisms are potential risk factors and that the IL-6 G/C and MBL AB polymorphisms are a protective factor for occurrence and recurrence of CA. PMID: 24118442
  98. Neonates with low serum MBL levels are more than four times more likely to have neonatal sepsis compared to those with higher serum MBL levels. PMID: 25105751
  99. High levels of MBL are associated with lower pulse wave velocity and the use of antihypertensive drugs in a cohort of patients with ESRD awaiting kidney transplantation. The MBL-genotype A/A clearly was most represented in the high MBL-group. PMID: 25281004
  100. MBL2-rs1800450CT single nucleotide polymorphism was associated with a significantly increased risk of developing wheezing. PMID: 25326706

Show More

Hide All

Subcellular Location Secreted
Tissue Specificity Plasma protein produced mainly in the liver.
Database Links

HGNC: 6922

OMIM: 154545

KEGG: hsa:4153

STRING: 9606.ENSP00000363079

UniGene: Hs.499674

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1