Recombinant Human Mannose-binding protein C(MBL2)

Code CSB-YP013540HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P11226
Relevance Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complent pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Collectin-1MBP1Mannan-binding protein;Mannose-binding lectin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Research Area Immunology
Source Yeast
Gene Names MBL2
Protein Names Recommended name: Mannose-binding protein C Short name= MBP-C Alternative name(s): Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin
Expression Region 21-248aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 26.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
Subcellular Location Secreted
Tissue Specificity Plasma protein produced mainly in the liver.
Database Links

HGNC: 6922

OMIM: 154545

KEGG: hsa:4153

STRING: 9606.ENSP00000363079

UniGene: Hs.499674

Pathway Complement and coagulation cascades

Related Products

MBL2 Antibodies

MBL2 Antibodies for Homo sapiens (Human)

MBL2 Proteins

MBL2 Proteins for Homo sapiens (Human)

MBL2 ELISA Kit

MBL2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.