Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
AI585868; BOS_22465; C86848; CDG 1; CDG1; CDG1a; CDGS; MGC127449; Phosphomannomutase 2; PMM 2; Pmm2; PMM2_HUMAN
Species
Homo sapiens (Human)
Expression Region
1-246aa
Target Protein Sequence
AAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human PMM2 recombinant protein was produced in E.coli, where the gene sequence encoding Human PMM2 (1-246aa) was expressed with the N-terminal GST tag. The purity of this PMM2 protein was greater than 90% by SDS-PAGE.
One of the primary functions of PMM2 is to catalyze the isomerization reaction between mannose-6-phosphate and mannose-1-phosphate. This reaction is a crucial step in the mannose metabolism pathway, generating mannose-1-phosphate, which is utilized in the synthesis of various important glycoproteins and sugar molecules. PMM2 mediates the synthesis and metabolism of mannose, which is vital for multiple biological processes. Glycoproteins are a class of proteins with attached sugar molecules, and they play roles in cell signaling, cell adhesion, immune system function, and more. Mutations in PMM2 are associated with a genetic disorder known as Phosphomannomutase 2 deficiency (PMM2-CDG). This is a rare metabolic disorder that results in abnormal glycoprotein synthesis, affecting the function of various organs and systems, including the nervous system, muscular system, immune system, and others. The symptoms and severity of PMM2-CDG can vary among individuals.