Recombinant Human Phosphomannomutase 2(PMM2)

Code CSB-EP018238HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O15305
Relevance Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
Research Area Signal Transduction
Source E.coli
Gene Names PMM2
Protein Names Recommended name: Phosphomannomutase 2 Short name= PMM 2 EC= 5.4.2.8
Expression Region 1-246aa
Tag Info N-terminal GST-tagged
Mol. Weight 55.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Involvement in disease Congenital disorder of glycosylation 1A (CDG1A)
Subcellular Location Cytoplasm
Protein Families Eukaryotic PMM family
Database Links

HGNC: 9115

OMIM: 212065

KEGG: hsa:5373

STRING: 9606.ENSP00000268261

UniGene: Hs.625732

Related Products

PMM2 Antibodies

PMM2 Antibodies for Homo sapiens (Human)

PMM2 Antibodies for Human

PMM2 Proteins

PMM2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.