Recombinant Human Programmed cell death protein 5(PDCD5)

Code CSB-EP017671HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O14737
Relevance May function in the process of apoptosis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias TF-1 cell apoptosis-related protein 19
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
Research Area Cell Biology
Source E.coli
Gene Names PDCD5
Protein Names Recommended name: Programmed cell death protein 5Alternative name(s): TF-1 cell apoptosis-related protein 19 Short name= Protein TFAR19
Expression Region 1-125aa
Tag Info N-terminal GST-tagged
Mol. Weight 41.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May function in the process of apoptosis.
Protein Families PDCD5 family
Tissue Specificity Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.
Database Links

HGNC: 8764

OMIM: 604583

KEGG: hsa:9141

STRING: 9606.ENSP00000466214

UniGene: Hs.443831

Related Products

PDCD5 Antibodies

PDCD5 Antibodies for Homo sapiens (Human)

PDCD5 Antibodies for Human

PDCD5 Proteins

PDCD5 Proteins for Homo sapiens (Human)

PDCD5 ELISA Kit

PDCD5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.