Recombinant Human Thyroid peroxidase(TPO),partial

Code	CSB-YP024112HU
Size	US$2010
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details
Related Products
Q&A and Customer Reviews
Target Data

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	TPO
Uniprot No.	P07202
Research Area	Cancer
Species	Homo sapiens (Human)
Source	Yeast
Expression Region	19-161aa
Target Protein Sequence	FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	17.9kDa
Protein Length	Partial
Tag Info	N-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.
Still Have Questions?	Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

■ Q&A

We are interested in several small units of many different products. However, we are only interested in products with a GST tag. For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag? CSB-YP024112HU His

Thanks for your inquiry，Note: We use different codes for different tags now, so the codes of these proteins have been updated below.
CSB-YP024112HUe0
Name: Recombinant Human Thyroid peroxidase(TPO),partial
Expression Region: 19-161aa, Partial
Tag Info: N-terminal GST-tag
Expression Sequence:

FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR

Shipping format: The default delivery form is liquid form. If the customer has demand for lyophilized form, please remark this requirement when placing order.
Optional service: Do you want aseptic processing and/or endotoxin removal for this protein (recommended for cell culture or in vivo use)? With our endotoxin removal service we guarantee the endotoxin level to be less than 0.1ng/ug (1EU ug). Both aseptic processing and endotoxin removal services are free of charge however they must be requested when the order is placed.
Purity: Greater than 90% as determined by SDS-

■ Customer Reviews

Submit CUSABIO Product Reciew in 2 Minutes, Win An Apple Watch!

Target Data

Function	Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4).
Involvement in disease	Thyroid dyshormonogenesis 2A (TDH2A)
Subcellular Location	Membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell surface
Protein Families	Peroxidase family, XPO subfamily
Database Links	HGNC: 12015 OMIM: 274500 KEGG: hsa:7173 STRING: 9606.ENSP00000318820 UniGene: Hs.467554