Code | CSB-YP024112HU |
Size | US$1298 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The fusion tag N-terminal 6xHis tag gene was added to the gene sequence corresponding to the yeast of the human TPO protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transfected into the yeast cells for expression. Following purification, the product is the recombinant human TPO protein carrying N-terminal 6xHis tag. The SDS-PAGE assessed the purity of this recombinant TPO protein up to 90%. It had an apparent molecular weight of approximately 40 kDa. This recombinant TPO protein may be used in the research of TPO-related cancer. TPO is a gene providing instructions for making a protein named thyroid peroxidase (abbreviated TPO) in human and belongs to peroxidase family and XPO subfamily. TPO is an enzyme normally found in the thyroid gland, plays an important role in the production of thyroid hormones. TPO is found in thyroid follicle cells where it converts the thyroid hormone T4 to T3. In clinic, the presence of TPO antibodies in your blood suggests that the cause of thyroid disease is an autoimmune disorder, such as Hashimoto's disease or Graves' disease. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | TPO |
Uniprot No. | P07202 |
Research Area | Cancer |
Alternative Names | MSA ; PERT_HUMAN; TDH2A; Thyroid microsomal antigen; Thyroid peroxidase; Thyroperoxidase; TPO; TPX |
Species | Homo sapiens (Human) |
Source | Yeast |
Expression Region | 19-161aa |
Target Protein Sequence | FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 17.9kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
We are interested in several small units of many different products. However, we are only interested in products with a GST tag. For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag? CSB-YP024112HU His
FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR
Function |
Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4).
|
Gene References into Functions |
|
Involvement in disease | Thyroid dyshormonogenesis 2A (TDH2A) |
Subcellular Location | Membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell surface. |
Protein Families | Peroxidase family, XPO subfamily |
Database Links |
HGNC: 12015 OMIM: 274500 KEGG: hsa:7173 STRING: 9606.ENSP00000318820 UniGene: Hs.467554 |