Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP024112HU |
| Product Type | Recombinant Protein |
| Size | US$2010 |
| Uniprot No. | P07202 |
| Relevance | Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T3 and T4. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR |
| Research Area | Cancer |
| Source | Yeast |
| Gene Names | TPO |
| Protein Names | Recommended name: Thyroid peroxidase Short name= TPO EC= 1.11.1.8 |
| Expression Region | 19-161aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 17.9kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4). |
| Involvement in disease | Thyroid dyshormonogenesis 2A (TDH2A) |
| Subcellular Location | Membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell surface |
| Protein Families | Peroxidase family, XPO subfamily |
| Database Links |
HGNC: 12015 OMIM: 274500 KEGG: hsa:7173 STRING: 9606.ENSP00000318820 UniGene: Hs.467554 |
| Pathway |
Th17 cell differentiation
Thyroid hormone synthesis |
We are interested in several small units of many different products. However, we are only interested in products with a GST tag. For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag? CSB-YP024112HU His
FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR
TPO Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA12279A0RB | TPO Antibody | Human | ELISA, IHC |
| CSB-PA12279B0RB | TPO Antibody, HRP conjugated | Human | ELISA |
| CSB-PA12279C0RB | TPO Antibody, FITC conjugated | Human | ELISA |
| CSB-PA12279D0RB | TPO Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA169016 | TPO Antibody | Human | ELISA,IHC |
TPO Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP024112HU CSB-BP024112HU CSB-MP024112HU |
Recombinant Human Thyroid peroxidase(TPO) ,partial, Escherichia Coli | E.coli Baculovirus Mammalian cell |
TPO ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E08351h | Human Thyroid-Peroxidase,TPO ELISA Kit | serum, plasma, tissue homogenates | 0.225 ng/mL |
Recombinant Rat Alpha-1-antiproteinase(Serpina1)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human CCAAT/enhancer-binding protein gamma(CEBPG)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ras-related C3 botulinum toxin substrate 3(RAC3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E),partial,Yeast
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Acinetobacter baumannii Elongation factor Tu(tuf1)
Express system: E.coli
Species: Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Recombinant Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit beta(nrdB)
Express system: E.coli
Species: Escherichia coli (strain K12)
Recombinant Juniperus ashei Pectate lyase 1
Express system: Yeast
Species: Juniperus ashei (Ozark white cedar)
Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin
Express system: Yeast
Species: Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
