Recombinant Human Thyroid peroxidase(TPO),partial

Code CSB-YP024112HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P07202
Relevance Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T3 and T4.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR
Research Area Cancer
Source Yeast
Gene Names TPO
Protein Names Recommended name: Thyroid peroxidase Short name= TPO EC= 1.11.1.8
Expression Region 19-161aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 17.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4).
Involvement in disease Thyroid dyshormonogenesis 2A (TDH2A)
Subcellular Location Membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell surface
Protein Families Peroxidase family, XPO subfamily
Database Links

HGNC: 12015

OMIM: 274500

KEGG: hsa:7173

STRING: 9606.ENSP00000318820

UniGene: Hs.467554

Pathway Th17 cell differentiation
Thyroid hormone synthesis

Q&A and Customer Reviews

Q&A
Q:

We are interested in several small units of many different products.  However, we are only interested in products with a GST tag.  For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag?   CSB-YP024112HU His

A:
Thanks for your inquiry,Note: We use different codes for different tags now, so the codes of these proteins have been updated below.
CSB-YP024112HUe0
Name: Recombinant Human Thyroid peroxidase(TPO),partial
Expression Region: 19-161aa, Partial
Tag Info: N-terminal GST-tag
Expression Sequence:

FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR


Shipping format: The default delivery form is liquid form. If the customer has demand for lyophilized form, please remark this requirement when placing order.
Optional service: Do you want aseptic processing and/or endotoxin removal for this protein (recommended for cell culture or in vivo use)? With our endotoxin removal service we guarantee the endotoxin level to be less than 0.1ng/ug (1EU ug). Both aseptic processing and endotoxin removal services are free of charge however they must be requested when the order is placed.
Purity: Greater than 90% as determined by SDS-
Customer Reviews

Related Products

TPO Antibodies

TPO Antibodies for Homo sapiens (Human)

TPO Proteins

TPO Proteins for Homo sapiens (Human)

TPO ELISA Kit

TPO ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.