Name: Recombinant Human Thyroid peroxidase(TPO),partial
Brand: CUSABIO
SKU: CSB-YP024112HU

Product Details

Description	The fusion tag N-terminal 6xHis tag gene was added to the gene sequence corresponding to the yeast of the human TPO protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transfected into the yeast cells for expression. Following purification, the product is the recombinant human TPO protein carrying N-terminal 6xHis tag. The SDS-PAGE assessed the purity of this recombinant TPO protein up to 90%. It had an apparent molecular weight of approximately 40 kDa. This recombinant TPO protein may be used in the research of TPO-related cancer. TPO is a gene providing instructions for making a protein named thyroid peroxidase (abbreviated TPO) in human and belongs to peroxidase family and XPO subfamily. TPO is an enzyme normally found in the thyroid gland, plays an important role in the production of thyroid hormones. TPO is found in thyroid follicle cells where it converts the thyroid hormone T4 to T3. In clinic, the presence of TPO antibodies in your blood suggests that the cause of thyroid disease is an autoimmune disorder, such as Hashimoto's disease or Graves' disease.
Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	TPO
Uniprot No.	P07202
Research Area	Cancer
Alternative Names	MSA ; PERT_HUMAN; TDH2A; Thyroid microsomal antigen; Thyroid peroxidase; Thyroperoxidase; TPO; TPX
Species	Homo sapiens (Human)
Source	Yeast
Expression Region	19-161aa
Target Protein Sequence	FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	17.9kDa
Protein Length	Partial
Tag Info	N-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	3-7 business days
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We are interested in several small units of many different products. However, we are only interested in products with a GST tag. For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag? CSB-YP024112HU His

Thanks for your inquiry，Note: We use different codes for different tags now, so the codes of these proteins have been updated below.
CSB-YP024112HUe0
Name: Recombinant Human Thyroid peroxidase(TPO),partial
Expression Region: 19-161aa, Partial
Tag Info: N-terminal GST-tag
Expression Sequence:

FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR

Shipping format: The default delivery form is liquid form. If the customer has demand for lyophilized form, please remark this requirement when placing order.
Optional service: Do you want aseptic processing and/or endotoxin removal for this protein (recommended for cell culture or in vivo use)? With our endotoxin removal service we guarantee the endotoxin level to be less than 0.1ng/ug (1EU ug). Both aseptic processing and endotoxin removal services are free of charge however they must be requested when the order is placed.
Purity: Greater than 90% as determined by SDS-

Target Background

Function	Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4).
Gene References into Functions	genetic association studies in population in Japan: Data suggest that SNPs in TPO (rs2071400 C/T, rs2071403 A/G) are associated with development of Hashimoto's disease and Graves' disease, but not with the prognosis of individual patients in the population studied. PMID: 28845025 Biochemical properties of the TPO protein expressed in cancer and normal breast tissue are similar to those observed for the thyroid TPO. Nevertheless, there are some differences in comparison with the thyroid-tissue expressed protein, such as a lower N-glycan content, a slightly smaller polypeptide length, a decreased enzymatic activity, and undetectable dimer formation. PMID: 29513734 For the first time, we have isolated thyroid peroxidase by immunocytochemistry in the granulosa cumulus cells of the human ovarian follicle, thereby supporting the hypothesis that the human ovarian follicle may be an independent thyroid-hormone producing unit. PMID: 28277109 study to examine the relationship between the Asn698Thr (A2095C) and Thr725Pro (A2173C) polymorphisms of the TPO gene and anti-TPO levels in patients with subclinical hypothyroidism; ncreased anti-TPO antibodies were significantly associated with the A2173C polymorphism PMID: 28500830 Low expression of TPO is associated with dilated cardiomyopathy and impaired left ventricular function accompanied by increased risk of death. PMID: 29320567 Our findings suggest that variants inside or near TPO, ATXN2 and RASGRP1 genes are associated with HT. Identified loci are novel to HT and represent good basis for further exploration of HT susceptibility. PMID: 27268232 Our study indicated that the prevalence of TPO mutations was 1% among studied Chinese patients with CH. A novel TPO variation c.1682C>T/p. T561M was found, thereby expanding the mutational spectrum of the gene. PMID: 27173810 It is concluded that TPO 2173A>C polymorphism may be considered as a risk factor for developing autoimmune thyroiditis in patients with allergic rhinitis and asthma and that these patients should regularly be checked for hidden thyroiditis. PMID: 28502155 TPO transcripts were present in both normal and breast cancer tissue samples, although the amounts in the latter were reduced. TPO levels are lower in more advanced cancers. PMID: 28575127 Biallelic TPO mutations most commonly underlie severe congenital hypothyroidism. PMID: 27525530 The results of the study suggest that rs11675434 SNP located near TPO is associated with the development of Graves ophthalmopathy, especially in males and patients with later age of the disease onset. PMID: 27829681 Mutations in the TPO gene are associated with Congenital hypothyroidism and thyroid dyshormonogenesis. PMID: 26894573 Compound heterozygous mutations in the TPO gene are associated with congenital hypothyroidism. PMID: 27135621 Studies suggest that Thyroid Peroxidase autoantibodies in early to mid-pregnancy is associated with concurrent depression and may be predictive of depression in the postpartum period. PMID: 27011366 a homozygous nonsense mutation (R540X) in two patients with congenital hypothyroidism; the strong genotype/phenotype correlation associated with this mutation PMID: 26777044 Anti-thyroid peroxidase (TPO) antibodies and male gender were significantly associated with glucose impairment in patients with beta thalassemia major. PMID: 27123460 Lower pretreatment serum CXCL10 levels are associated with thyroid dysfunction. Thyroid dysfunction prevalence increases in female patients and patients who are positive for TPOAb at baseline. PMID: 26361424 This is the first description of a TD causing mutation in Tunisia and thus may help to develop a genetic screening protocol for congenital hypothyroidism in the studied region. PMID: 25968604 Two novel inactivating mutations (c.1970T> C and c.2665G> T) in the TPO gene cause congenital hypothyroidism. PMID: 26174974 function and autoantigenicity of TPO PMID: 26623656 This study confirms the pathogenicity of Y55X mutation in two patients with congenital hypothyroidism and demonstrates that a nonsense mutation in the amino-terminal coding region of the TPO gene could totally abolish the function of the TPO enzyme leading to total iodide organification defect. PMID: 25328990 analysis of thyroid peroxidase autoantibody levels in type 1 diabetes in discordant twin pairs PMID: 26070305 Data show that thyroperoxidase (TPO) single nucleotide polymorphisms (SNPs) rs4927611 TT and rs732609 CC are genotypes associated with potential risk for the congenital hypothyroidism (CH). PMID: 26663066 A single base deletion in the carboxyl-terminal coding region of the TPO gene could cause congenital hypothyroidism and helps to establish a genotype/phenotype correlation associated with the mutation. PMID: 25241611 Molecular cloning and functional studies of wild type and mutant forms harboring missense mutations in TPO gene showed decreased activity in the three mutants, higher Km values and lower reaction efficiencies (Vmax/Km). PMID: 25576858 The effects of inhibition of the TPO/c-MPL pathway on enhancing the chemotherapy sensitivity of AML cells. PMID: 24085601 The detection of the novel c.670_672del and c.1186C>T alterations expand the mutation spectrum of TPO associated with thyroid dyshormonogenesis. PMID: 25564141 The vWA and TPOX microsatellites are good candidate biomarkers in venous thromboembolism diseases and could help to elucidate their origins. PMID: 25250329 Variable clinical phenotypes in a family with homozygous c.1159G>A mutation in the thyroid peroxidase gene. PMID: 24717978 In conclusion, the c.2268dup mutation leads to the formation of normal and alternatively spliced TPO mRNA transcripts with a consequential loss of TPO enzymatic activity in Malaysian-Chinese patients with goitrous CH. PMID: 24745015 The results provide insight into why individuals with thyroid autoimmunity do or do not eventually develop thyroid disease, and these markers may therefore predict which TPOAb-positives are particularly at risk of developing clinical thyroid dysfunction. PMID: 24586183 The study suggested the possibility of TPO gene polymorphisms as a possible pathogenetic mechanism of hypothyroidism. PMID: 24420335 presented two children with CH who were born to consanguineous parents and were homozygous carriers of a missense (G319R) TPO mutation, the mutation segregated with the disease status in the families confirming its pathogenicity PMID: 24158420 There was shown an association of polymorphic variants of the gene DIO2 (274A > G) with elevated levels of antibodies to TPO and TPO gene (2173A > C) with elevated levels of free T4. PMID: 25306702 Our results point to a redundant role for the propeptide sequence in TPO. It is expressed in a membrane-anchored, enzymatically active form that is insensitive to intramolecular proteolysis, and importantly is recognized by patients' autoantibodies PMID: 23668778 One fourth of type 1 diabetes mellitus pregnant women presented with positive anti-TPO antibodies. However, the presence of anti-TPO antibodies does not seem to be related with worse metabolic control or adverse pregnancy outcome. PMID: 23985426 21 TPO mutations in 28 thyroid dyshormonogenesis cases were identified showing potential linkage to this locus PMID: 23236987 Congenital goitrous primary hypothyroidism in two German families caused by novel thyroid peroxidase (TPO) gene mutations PMID: 23512414 TPO as a gene involved in the risk of differentiated thyroid carcinoma (DTC). PMID: 23754668 congenital goitrous hypothyroidism of the Chinese siblings was due to the TPO gene mutations (c.2268-2269 insT and c.2089 G>A) PMID: 23329183 Data indicate that the association between miscarriage and increased anti-thyroid peroxidase antibodies (TPOAb) levels. PMID: 23672306 Positive anti-TPO antibody in asthmatic patients may show presence of a hidden autoimmune thyroiditis in these patients. PMID: 22947910 In a consanguineous Pakistani family with intellectual disability, Homozygosity mapping located the causative defect on chromosome 2p25.3-p25.2. Targeted next-generation sequencing revealed an intragenic deletion of 5 exons of TPO. PMID: 22387573 analysis of how minimally invasive follicular thyroid carcinoma developed in dyshormonogenetic multinodular goiter due to thyroid peroxidase gene mutation [case report] PMID: 22435912 the correlation between TPOab and diagnostic parameters among newly diagnosed breast cancer patients PMID: 22149743 Findings confirm the genetic heterogeneity of TPO defects and the importance of the implementation of molecular studies to determinate the aetiology of the CH with dyshormonogenesis. PMID: 21981063 Data suggest that in Hashimoto's thyroiditis, both antigens, TPO and thyroglobulin, are recognized by peripheral and thyroid gland infiltrating CD8-positive T-cells and are involved in thyroid destruction leading to clinical disease manifestation. PMID: 22259066 The study identified underlying TSHR and TPO mutations in Korean patients with congenital hypothyroidism and revealed a possible relationship between imaging findings and mutation status. PMID: 21707688 In the presence of the C allele of T1936C, Anti-TPO level was significantly increased. PMID: 22326521 A high frequency of mutation in the TPO gene was detected in patients with congenital hypothyroidism. PMID: 22093430 Show More Hide All
Involvement in disease	Thyroid dyshormonogenesis 2A (TDH2A)
Subcellular Location	Membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell surface.
Protein Families	Peroxidase family, XPO subfamily
Database Links	HGNC: 12015 OMIM: 274500 KEGG: hsa:7173 STRING: 9606.ENSP00000318820 UniGene: Hs.467554

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-YP024112HU
Size	US$1298
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Thyroid peroxidase(TPO),partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage