Recombinant Methylobacterium extorquens SsrA-binding protein(smpB)

Product Type Recombinant Protein
Uniprot No. A9VYY7
Species Methylobacterium extorquens (strain PA1)
Gene Names smpB
Protein Names Recommended name: SsrA-binding protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.
Subcellular Location Cytoplasm
Protein Families SmpB family
Database Links

KEGG: mex:Mext_3192

STRING: 419610.Mext_3192

Product Details for Different Expression Systems

Product Name Recombinant Methylobacterium extorquens SsrA-binding protein(smpB),Yeast
Code CSB-YP433329MNY
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAPKPDPGRRVVADNRSARYHYAIEDTLEAGIALTGTEVKSLRGGKATIGESYAGPSGND LMLFNAYIPEYLEANRFNHDTKRPRRLLLHRRQINKLIGATQRQGYTVIPLKIYFNDKGR AKVELGLGKGKQLHDKRESVKQRDWDRDKARLMRDKG
Expression Region 1-157
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Methylobacterium extorquens SsrA-binding protein(smpB),E.coli
Code CSB-EP433329MNY
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAPKPDPGRRVVADNRSARYHYAIEDTLEAGIALTGTEVKSLRGGKATIGESYAGPSGND LMLFNAYIPEYLEANRFNHDTKRPRRLLLHRRQINKLIGATQRQGYTVIPLKIYFNDKGR AKVELGLGKGKQLHDKRESVKQRDWDRDKARLMRDKG
Expression Region 1-157
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Methylobacterium extorquens SsrA-binding protein(smpB),Baculovirus
Code CSB-BP433329MNY
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAPKPDPGRRVVADNRSARYHYAIEDTLEAGIALTGTEVKSLRGGKATIGESYAGPSGND LMLFNAYIPEYLEANRFNHDTKRPRRLLLHRRQINKLIGATQRQGYTVIPLKIYFNDKGR AKVELGLGKGKQLHDKRESVKQRDWDRDKARLMRDKG
Expression Region 1-157
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Methylobacterium extorquens SsrA-binding protein(smpB),Mammalian cell
Code CSB-MP433329MNY
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAPKPDPGRRVVADNRSARYHYAIEDTLEAGIALTGTEVKSLRGGKATIGESYAGPSGND LMLFNAYIPEYLEANRFNHDTKRPRRLLLHRRQINKLIGATQRQGYTVIPLKIYFNDKGR AKVELGLGKGKQLHDKRESVKQRDWDRDKARLMRDKG
Expression Region 1-157
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.