Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Atp5b

Uniprot No.

P56480

Research Area

Tags & Cell Markers

Alternative Names

Atp5f1b; Atp5b; ATP synthase subunit beta; mitochondrial; EC 7.1.2.2; ATP synthase F1 subunit beta

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

230-529aa

Target Protein Sequence

YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHGS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

52.8kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The gene coding for the Mouse ATP5B protein (230-529aa) is introduced into a plasmid vector, creating recombinant plasmid that is subsequently transformed into e.coli cells. e.coli cells capable of surviving in the presence of a specific antibiotic are selected and then cultured under conditions favorable for the expression of the gene of interest. A N-terminal 10xHis-SUMO tag and C-terminal Myc tag is attached to the protein. Post-expression, the recombinant Mouse ATP5B protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Mouse ATP5B protein, revealing a purity exceeding 85%.

Target Background

Function

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.

Gene References into Functions

The results of this study found that the expression levels of Cd68 and Atp5b were significantly correlated with the neurofibrillary tangle burden in the Alzheimer's Disease brain and with their cognition. PMID: 27911303
Results show that the relationship between ATPsyn-beta and insulin secretion deficiency suggests that ATPsyn-beta potentially could serve as a marker for type 2 diabetes mellitus disease risk in women with polycystic ovary syndrome. PMID: 28397049
Data show that overexpressed ATP synthase subunit-beta (ATP5b) was significantly located on renal proximal tubules in db/db mice. PMID: 26449648
Aging altered the expression of ATP synthase subunit beta. PMID: 25659849
inhibition of calmodulin (CaM) completely abolished ATPSbeta-induced Akt activation in liver cells PMID: 24296716
association of calcium channel alpha2/delta subunit 1 and ATP5b occurs in intracellular membranes and at the plasma membrane of developing muscle cells, where they form a signaling complex capable of accelerating the rate of decline of calcium transients PMID: 21490313
Adipocyte recycling of apoA-I is a selective process that involves the ectopically expressed beta-subunit of ATP synthase. PMID: 21069432
Disturbed flow and hypercholesterolemia synergistically promote gamma/delta T-lymphocyte activation by the membrane translocation of ATPSbeta in endothelial cells. PMID: 21193741
Neuron-specific changes for F(1)-complex in the Ppt1-deficient cells and give clues for a possible link between lipid metabolism and neurodegeneration in Infantile neuronal ceroid lipofuscinosis. PMID: 18245779
Downregulated ATP5b also reduced ATP production in the murine macrophages infected with B. anthracis spores. PMID: 18467876
CyPD association to the lateral stalk of ATP synthase modulates the activity of the complex PMID: 19801635

Hide All

Subcellular Location

Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.

Protein Families

ATPase alpha/beta chains family

Database Links

KEGG: mmu:11947

STRING: 10090.ENSMUSP00000026459

UniGene: Mm.238973

Code	CSB-EP002350MO1
Abbreviation	Recombinant Mouse ATP5B protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse ATP synthase subunit beta, mitochondrial (Atp5f1b), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage