Code | CSB-EP806542MOa2 |
Size |
US$2466Purchase it in Cusabio online store (only available for customers from the US) |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | Klk14 |
Uniprot No. | Q8CGR5 |
Research Area | Tags & Cell Markers |
Alternative Names | Glandular kallikrein KLK14 |
Species | Mus musculus (Mouse) |
Source | E.coli |
Expression Region | 24-250aa |
Target Protein Sequence | IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 40.5kDa |
Protein Length | Full Length of Mature Protein |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis (By similarity). |
Subcellular Location | Secreted, extracellular space |
Protein Families | Peptidase S1 family, Kallikrein subfamily |
Database Links |
KEGG: mmu:317653 STRING: 10090.ENSMUSP00000056935 UniGene: Mm.247377 |
Recombinant Mouse Pyridoxal phosphate phosphatase(Pdxp)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Visinin-like protein 1(VSNL1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Glutathione S-transferase alpha-1(Gsta1)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Vitamin D-binding protein(GC),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Bovine Keratin, type I cytoskeletal 17(KRT17)
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Rat 3-hydroxyacyl-CoA dehydrogenase type-2(Hsd17b10)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human Bcl-2-like protein 11(BCL2L11)
Express system: Yeast
Species: Homo sapiens (Human)