Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP806542MOa2 |
| Product Type | Recombinant Protein |
| Size |
US$2466Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | Q8CGR5 |
| Lead Time | 3-7 business days |
| Relevance | Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Glandular kallikrein KLK14 |
| Species | Mus musculus (Mouse) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN |
| Research Area | Tags & Cell Markers |
| Source | E.coli |
| Gene Names | Klk14 |
| Expression Region | 24-250aa |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Mol. Weight | 40.5kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis (By similarity). |
| Subcellular Location | Secreted, extracellular space |
| Protein Families | Peptidase S1 family, Kallikrein subfamily |
| Database Links |
KEGG: mmu:317653 STRING: 10090.ENSMUSP00000056935 UniGene: Mm.247377 |
Klk14 Antibodies for Mus musculus (Mouse)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA806542ZA01MO | Klk14 Antibody | Mus musculus | ELISA, WB (ensure identification of antigen) |
| CSB-PA806542ZA01MO | Klk14 Antibody | Mus musculus | ELISA, WB (ensure identification of antigen) |
Klk14 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP806542MO | Recombinant Mouse Kallikrein-14(Klk14) | Yeast |
| CSB-EP806542MO | Recombinant Mouse Kallikrein-14(Klk14) | E.coli |
| CSB-BP806542MO CSB-MP806542MO |
Recombinant Mouse Kallikrein-14(Klk14) | Baculovirus Mammalian cell |
Klk14 ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL012451MO | Mouse Kallikrein-14(KLK14) ELISA kit | serum, plasma, tissue homogenates | 0.039 ng/mL |
Recombinant Human Zinc finger protein GLI2(GLI2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human G2/mitotic-specific cyclin-B1(CCNB1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Complement receptor type 1(CR1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial
Express system: E.coli
Species: Homo sapiens (Human)
