Recombinant Mouse Monoglyceride lipase(Mgll)

Code CSB-EP013787MOa2
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP013787MOa2 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mgll.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP013787MOa2 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mgll.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Mgll
Uniprot No. O35678
Research Area Cardiovascular
Alternative Names MgllMonoglyceride lipase; MGL; EC 3.1.1.23; Monoacylglycerol lipase; MAGL
Species Mus musculus (Mouse)
Source E.coli
Expression Region 1-303aa
Target Protein Sequence MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 49.4kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain
Gene References into Functions
  1. Neuronal and astrocytic monoacylglycerol lipase contributes to 2-arachidonoylglycerol clearance and prevent CB1 receptor over-stimulation in the cerebellum. PMID: 27775008
  2. Results provide evidence that MGL deficiency causes complex changes in cholesterol metabolism and in the regulation of gut transit. PMID: 28380440
  3. N-arachidonoyl ethanolamine and 2-arachidonoyl glycerol hydrolyzing enzymes, FAAH and MAGL, and the CB1 receptor link the endocannabinoid system to broader lipid signaling networks in contrasting ways, potentially altering neurotransmission and behavior independently of cannabinoid receptor signaling. PMID: 27109320
  4. Results suggest that neuronal and astrocytic MAGL collaborate to terminate endocannabinoid-mediated synaptic suppression and prompt synapse-specificity of endocannabinoid signaling in the cerebellum. PMID: 27182552
  5. Activities of adipose triglyceride lipase (ATGL), hormone sensitive lipolitic enzyme (HSL) and monoacylglycerol lipase (MGL) were significantly higher (51 %, 38 %, 49 %) in the DE group than the HF group (p < 0.05). MGL, there were no differences between the CO group, HF group, and DC group, with the DE group (70 %) being significantly higher (p < 0.05). PMID: 27596982
  6. MGL in astrocytes is an important regulator of 2-arachidonoylglyerol levels, arachidonic acid availability, and neuroinflammation. PMID: 26565024
  7. Genetic and pharmacological ablation of Magl attenuated centrally-mediated fever response. PMID: 26287872
  8. the results indicate that global MGL deletion leads to systemic changes that produce a leaner phenotype and an improved serum metabolic profile. PMID: 25842377
  9. This study showed that Genetic deletion of monoacylglycerol lipase leads to impaired cannabinoid receptor CBR signaling and anxiety-like behavior. PMID: 26223500
  10. Suggest that organophosphate agents induce plasma hypertriglyceridemia in mouse through single or dual inhibition of FAAH or/and MAGL, apparently leading to overstimulation of cannabinoid signal regulating energy metabolism. PMID: 24361246
  11. Inactivation of Monoacylglycerol lipase robustly suppressed production and accumulation of beta-amyloid (Abeta) associated with reduced expression of beta-site amyloid precursor protein cleaving enzyme 1 (BACE1) in a mouse model of Alzheimer's disease. PMID: 23122958
  12. Data indicate that nerve growth factor (NGF) controls monoacylglycerol lipase (MGL) degradation in vitro and in vivo. PMID: 23319656
  13. The results therefore suggest a role for intestinal MGL in whole body energy balance via regulation of food intake as well as metabolic rate. PMID: 22937137
  14. MGL regulates 2-arachidonoylglycerol signaling rather broadly within a certain range of neural tissue, although MGL expression is heterogeneous and limited to a subset of nerve terminals and astrocytes. PMID: 22783023
  15. results indicate that genetic deletion of MAGL causes profound changes in eCB signaling, long-term synaptic plasticity, and learning behavior. PMID: 21940435
  16. pathway exists in brain where MAGL hydrolyzes 2-arachidonoylglycerol to generate arachidonate precursor pool for neuroinflammatory prostaglandins; found MAGL as metabolic node coupling endocannabinoid to prostaglandin signaling networks in nervous system PMID: 22021672
  17. MGL deficiency impairs lipolysis and attenuates diet-induced insulin resistance PMID: 21454566
  18. MAGL is the major regulator of 2- arachidonoylglycerol (2-AG) levels and signaling. PMID: 20855465
  19. spatially confined MGL activity generates a 2-arachidonoyl glycerol sensing microdomain and configures 2-arachidonoyl glycerol signaling to promote axonal growth PMID: 20962221
  20. sustained inactivation of monoacylglycerol lipase impairs specific endocannabinoid-mediated forms of synaptic plasticity; ligand diversification may be important for shaping the distinct functions and properties of endocannabinoid signaling pathways PMID: 20729846
  21. Astrocytes express monoacylglycerol lipase, the main hydrolyzing enzyme of 2-arachidonoylglycerol. Pharmacological inhibition of MGL potentiates ATP-induced 2-AG production. PMID: 15371507
  22. analysis of developmental and nutritional regulation of monoacylglycerol lipase and monoacylglycerol acyltransferase PMID: 17848545

Show More

Hide All

Subcellular Location Cytoplasm, cytosol, Membrane, Peripheral membrane protein
Protein Families AB hydrolase superfamily, Monoacylglycerol lipase family
Tissue Specificity Ubiquitous.
Database Links

KEGG: mmu:23945

STRING: 10090.ENSMUSP00000127374

UniGene: Mm.272197

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1