Recombinant Mouse Monoglyceride lipase(Mgll)

Code CSB-EP013787MOa2
Product Type Recombinant Protein
Size US$2466
Uniprot No. O35678
Relevance Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP013787MOa2 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mgll.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP013787MOa2 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mgll.
Storage Buffer Tris-based buffer,50% glycerol
Alias Monoacylglycerol lipase
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP
Research Area Cardiovascular
Source E.coli
Gene Names Mgll
Expression Region 1-303aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 49.4kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain
Subcellular Location Cytoplasm, cytosol, Membrane, Peripheral membrane protein
Protein Families AB hydrolase superfamily, Monoacylglycerol lipase family
Tissue Specificity Ubiquitous.
Database Links

KEGG: mmu:23945

STRING: 10090.ENSMUSP00000127374

UniGene: Mm.272197

Related Products

Mgll Antibodies

Mgll Antibodies for Mus musculus (Mouse)

Mgll Proteins

Mgll Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.