Recombinant Shewanella piezotolerans UPF0234 protein swp_1151 (swp_1151)

Product Type Recombinant Protein
Uniprot No. B8CKA9
Species Shewanella piezotolerans (strain WP3 / JCM 13877)
Gene Names swp_1151
Protein Names Recommended name: UPF0234 protein swp_1151
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Product Details for Different Expression Systems

Product Name Recombinant Shewanella piezotolerans UPF0234 protein swp_1151 (swp_1151),Yeast
Code CSB-YP490253SYW
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MPSMDIVSEVNEVELRNAVDNSVRELKSRFDFRGKEASIEYKDHVVTLSAEDDFQCQQLV DILRMQMSKRNVDPKSMDVDDKAVHSGKTFSLRVKFKEGIETLIAKKLVKLIKDSKLKVQ SSIQGDSVRVTGKKRDDLQAVMALAREADLGQPFQFNNFRD
Expression Region 1-161
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella piezotolerans UPF0234 protein swp_1151 (swp_1151),E.coli
Code CSB-EP490253SYW
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MPSMDIVSEVNEVELRNAVDNSVRELKSRFDFRGKEASIEYKDHVVTLSAEDDFQCQQLV DILRMQMSKRNVDPKSMDVDDKAVHSGKTFSLRVKFKEGIETLIAKKLVKLIKDSKLKVQ SSIQGDSVRVTGKKRDDLQAVMALAREADLGQPFQFNNFRD
Expression Region 1-161
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella piezotolerans UPF0234 protein swp_1151 (swp_1151),Baculovirus
Code CSB-BP490253SYW
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MPSMDIVSEVNEVELRNAVDNSVRELKSRFDFRGKEASIEYKDHVVTLSAEDDFQCQQLV DILRMQMSKRNVDPKSMDVDDKAVHSGKTFSLRVKFKEGIETLIAKKLVKLIKDSKLKVQ SSIQGDSVRVTGKKRDDLQAVMALAREADLGQPFQFNNFRD
Expression Region 1-161
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella piezotolerans UPF0234 protein swp_1151 (swp_1151),Mammalian cell
Code CSB-MP490253SYW
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MPSMDIVSEVNEVELRNAVDNSVRELKSRFDFRGKEASIEYKDHVVTLSAEDDFQCQQLV DILRMQMSKRNVDPKSMDVDDKAVHSGKTFSLRVKFKEGIETLIAKKLVKLIKDSKLKVQ SSIQGDSVRVTGKKRDDLQAVMALAREADLGQPFQFNNFRD
Expression Region 1-161
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.