Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

srtA

Uniprot No.

Q2FV99

Research Area

Microbiology

Alternative Names

srtA; SAOUHSC_02834; Sortase A; Surface protein sorting A

Species

Staphylococcus aureus (strain NCTC 8325)

Source

E.coli

Expression Region

25-206aa

Target Protein Sequence

AKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.9 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Staphylococcus aureus (strain NCTC 8325) srtA contains amino acids 25-206. The calculated molecular weight for this srtA protein is 24.9 kDa. This protein is generated in a e.coli-based system. The srtA gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant srtA protein during the following stages.

Staphylococcus aureus sortase A (SrtA) is an enzyme crucial for viral virulence and pathogenesis. SrtA is a transpeptidase that anchors surface proteins to the bacterial cell wall by catalyzing the covalent attachment of these proteins to peptidoglycan. This process is known as sortase-mediated anchoring and is essential for the display of virulence factors on the bacterial surface. The anchored proteins play a role in host-cell adhesion, immune evasion, and biofilm formation. Due to its importance in S. aureus pathogenicity, SrtA has been explored as a potential target for developing antimicrobial strategies against staphylococcal infections.

Target Background

Function

Transpeptidase that anchors surface proteins to the cell wall. Recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal. Following cleavage, a covalent intermediate is formed via a thioester bond between the sortase and its substrate, which is then transferred and covalently attached to the cell wall. This sortase recognizes a Leu-Pro-x-Thr-Gly (LPXTG) motif, which is cleaved by the sortase between the threonine and glycine residues. Utilizes lipid II as the peptidoglycan substrate for the sorting reaction. Responsible for the display of important virulence factors. Important for interactions with the host and host colonization during infection.

Subcellular Location

Cell membrane; Single-pass type II membrane protein.

Code	CSB-EP3093FLF
Abbreviation	Recombinant Staphylococcus aureus srtA protein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Staphylococcus aureus Sortase A (srtA), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage