Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
srtA; SAOUHSC_02834; Sortase A; Surface protein sorting A
Species
Staphylococcus aureus (strain NCTC 8325)
Expression Region
25-206aa
Target Protein Sequence
AKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Staphylococcus aureus (strain NCTC 8325) srtA contains amino acids 25-206. The calculated molecular weight for this srtA protein is 24.9 kDa. This protein is generated in a e.coli-based system. The srtA gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant srtA protein during the following stages.
Staphylococcus aureus sortase A (SrtA) is an enzyme crucial for viral virulence and pathogenesis. SrtA is a transpeptidase that anchors surface proteins to the bacterial cell wall by catalyzing the covalent attachment of these proteins to peptidoglycan. This process is known as sortase-mediated anchoring and is essential for the display of virulence factors on the bacterial surface. The anchored proteins play a role in host-cell adhesion, immune evasion, and biofilm formation. Due to its importance in S. aureus pathogenicity, SrtA has been explored as a potential target for developing antimicrobial strategies against staphylococcal infections.
