Recombinant Agrobacterium tumefaciens Protein virB6(virB6)

Code CSB-CF356492AEZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P05356
Storage Buffer Tris-based buffer,50% glycerol
Species Agrobacterium tumefaciens (strain 15955)
Sequence MNFTIPAPFTAIHTIFDVAFTTGLDSMLETIQEAVSAPLIACVTLWIIVQGILVIRGEVD TRSGITRVITVTIVVALIVGQANYQDYVVSIFEKTVPIFVQQFSVTGLPLQTVPAQLDTI FAVTQAVFQKIASEIGPMNDQDILAFQGAQWVLYGTLWSAFGVYDAVGILTKVLLAIGPL ILVGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIVILTEATALTLMLGVITFAGTTA AKIIGLYELDMFFLTGDALIVALPAIAGNIGGSYWSGATQSASSLYRRFAQVERG
Source in vitro E.coli expression system
Gene Names virB6
Protein Names Recommended name: Protein virB6
Expression Region 1-295
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function VirB proteins are suggested to act at the bacterial surface and there play an important role in directing T-DNA transfer to plant cells.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families TrbL/VirB6 family

Related Products

virB6 Proteins

virB6 Proteins for Agrobacterium tumefaciens (strain 15955)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.