Recombinant Anguilla anguilla Rhodopsin, deep-sea form

Code CSB-CF835443BZF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q90214
Storage Buffer Tris-based buffer,50% glycerol
Species Anguilla anguilla (European freshwater eel) (Muraena anguilla)
Sequence MNGTEGPNFYIPMSNITGVVRSPFEYPQYYLAEPWAYTILAAYMFTLILLGFPVNFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTVYTSMHGYFVFGETGCNLEGYFATLG GEISLWSLVVLAIERWVVVCKPMSNFRFGENHAIMGLAFTWIMANSCAMPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFIVHFSVPLTIISFCYGRLVCTVKEAAAQQQES ETTQRAEREVTRMVVIMVIAFLVCWVPYASVAWYIFTHQGSTFGPVFMTVPSFFAKSSAI YNPLIYICLNSQFRNCMITTLFCGKNPFQEEEGASTTASKTEASSVSSVSPA
Source in vitro E.coli expression system
Protein Names Recommended name: Rhodopsin, deep-sea form
Expression Region 1-352
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments such as rhodopsin and porphyropsin are light-absorbing molecules that mediate vision. Rhodopsin consists of an apoprotein, opsin, covalently linked to 11-cis-retinal. This receptor is coupled to the activation of phospholipase C. Porphyropsin consists of opsin covalently linked to 11-cis 3,4-didehydroretinal.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Rod shaped photoreceptor cells which mediates vision in dim light.

Related Products

Proteins

Proteins for Anguilla anguilla (European freshwater eel) (Muraena anguilla)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.