Recombinant Bacillus subtilis Quinol oxidase subunit 2(qoxA)

Code CSB-CF330405BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P34957
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence CSNASVLDPKGPVAEQQSDLILLSIGFMLFIVGVVFVLFTIILVKYRDRKGKDNGSYNPE IHGNTFLEVVWTVIPILIVIALSVPTVQTIYSLEKAPEATKDKEPLVVYATSVDWKWVFS YPEQDIETVNYLNIPVDRPILFKISSADSMASLWIPQLGGQKYAMAGMLMDQYLQADKVG TYEGRNANFTGEHFADQEFDVNAVTEKDFNSWVKKTQNEAPKLTKEKYDELMLPENVDEL TFSSTHLKYVDHGQDAEYAMEARKRLGYQAVSPHSKTDPFENVKKNEFKKSDDTEE
Source in vitro E.coli expression system
Gene Names qoxA
Protein Names Recommended name: Quinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Oxidase aa(3)-600 subunit 2 Quinol oxidase aa3-600, subunit QoxA Quinol oxidase polypeptide II
Expression Region 26-321
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes quinol oxidation with the concomitant reduction of oxygen to water. Major component for energy conversion during vegetative growth. Subunit II transfers the electrons from a quinol to the binuclear center of the catalytic subunit I (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Cytochrome c oxidase subunit 2 family
Database Links

KEGG: bsu:BSU38170

STRING: 224308.Bsubs1_010100020606

Related Products

qoxA Proteins

qoxA Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.