Recombinant Bacillus subtilis Uncharacterized membrane protein yjbE(yjbE)

Code CSB-CF518262BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O31603
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MEHDYLISLLVIVGIDLILGGDNAVVIAMASRHLPDKQRQQAIILGTFIAVAMRIGLTSA AVYLLNIPFLQCAGGIFLLYLGYQLLIEKKDTKHIKSSTSLWRAIRTIVLADLFMSLDNV IAVAGASHGEFSLVVIGLCVSVPVIIWGSKLIHIALEKIPLLIYAGSGLLAYTGGEMIVR DKKLSLFMAQHGTVETLLPILTVAFVILASIYYQQVEK
Source in vitro E.coli expression system
Gene Names yjbE
Protein Names Recommended name: Uncharacterized membrane protein yjbE
Expression Region 1-218
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families TerC family
Database Links

KEGG: bsu:BSU11510

STRING: 224308.Bsubs1_010100006361

Related Products

yjbE Proteins

yjbE Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.