Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF518262BRJ |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | O31603 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Bacillus subtilis (strain 168) |
| Sequence | MEHDYLISLLVIVGIDLILGGDNAVVIAMASRHLPDKQRQQAIILGTFIAVAMRIGLTSA AVYLLNIPFLQCAGGIFLLYLGYQLLIEKKDTKHIKSSTSLWRAIRTIVLADLFMSLDNV IAVAGASHGEFSLVVIGLCVSVPVIIWGSKLIHIALEKIPLLIYAGSGLLAYTGGEMIVR DKKLSLFMAQHGTVETLLPILTVAFVILASIYYQQVEK |
| Source | in vitro E.coli expression system |
| Gene Names | yjbE |
| Protein Names | Recommended name: Uncharacterized membrane protein yjbE |
| Expression Region | 1-218 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | TerC family |
| Database Links |
KEGG: bsu:BSU11510 STRING: 224308.Bsubs1_010100006361 |
yjbE Proteins for Bacillus subtilis (strain 168)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP518262BRJ1 CSB-EP518262BRJ1 CSB-BP518262BRJ1 CSB-MP518262BRJ1 |
Recombinant Bacillus subtilis Uncharacterized membrane protein yjbE(yjbE),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Hydroxymethylglutaryl-CoA lyase, mitochondrial(HMGCL)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Alpha-tocopherol transfer protein(TTPA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E),partial,Yeast
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Bovine L-2-hydroxyglutarate dehydrogenase, mitochondrial(L2HGDH)
Express system: E.coli
Species: Bos taurus (Bovine)
