Recombinant Bacillus subtilis Uncharacterized sugar transferase EpsL(epsL)

Code CSB-CF301759BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P71062
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MILKRLFDLTAAIFLLCCTSVIILFTIAVVRLKIGSPVFFKQVRPGLHGKPFTLYKFRTM TDERDSKGNLLPDEVRLTKTGRLIRKLSIDELPQLLNVLKGDLSLVGPRPLLMDYLPLYT EKQARRHEVKPGITGWAQINGRNAISWEKKFELDVWYVDNWSFFLDLKILCLTVRKVLVS EGIQQTNHVTAERFTGSGDVSS
Source in vitro E.coli expression system
Gene Names epsL
Protein Names Recommended name: Uncharacterized sugar transferase EpsL EC= 2.-.-.-
Expression Region 1-202
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in the production of the exopolysaccharide (EPS) component of the extracellular matrix during biofilm formation. EPS is responsible for the adhesion of chains of cells into bundles.
Subcellular Location Cell membrane, Single-pass membrane protein
Protein Families Bacterial sugar transferase family
Database Links

KEGG: bsu:BSU34250

STRING: 224308.Bsubs1_010100018566

Related Products

epsL Proteins

epsL Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.