Recombinant Bartonella henselae Type IV secretion system-coupling protein virD4(virD4)

Code CSB-CF756686BSG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6G2A8
Storage Buffer Tris-based buffer,50% glycerol
Species Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Sequence MKYTKTQLALISMPIASGALTIFLVPHMLSFVINDLKTNQIYWYVRSEPLLTLMLVAAVS LFYTLSQKLHLRKAITFVSTAFFCITALYYIGSEIKRLNPYVGQQGITWGYALKFMDPMV VFGVILGFVLLAIQVIITSPRTSNVKRAKKGIFGDAAWMNLKEAARIFPSNGQIVIGERY RVDQDNVRNIPFAPGNKTTWGKGGTAPLLTFNLDFGSTHMIFFAGSGGYKTTSTVVPTCL TYTGPIVCLDPSTEIAPMVKFARKKMGNRNVIILDPNSLLTKNFNVLDWLLDENIPRTRR EANIVSFSKLLLSEKKSENSSAEYFSTQAHNLLTALLAHVIFSDKYEDSERNLKTLRAIL SQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQTFSGVYTTASKDTQWLSLSNYADL VCGNDFASSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGNYKKRVLFVL DEVDLLGYMNILEEARDRGRKYGTSLMLFYQSSGQLVNHFGEAGARSWFESCSFVSYAAI KDLQTAKDISERCGQMTIEVTGTSKSRGLSLTKGSQNINYQQRALILPHEIIQEMRQDEQ IILMQGHPPLRCGRAIYFRRKEMLAATEKNRFAPQAKKS
Source in vitro E.coli expression system
Gene Names virD4
Protein Names Recommended name: Type IV secretion system-coupling protein virD4
Expression Region 1-639
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The type IV secretion system VirB/VirD4 is a major virulence determinant for subversion of human endothelial cell (HEC) function. VirB-dependent changes of HEC include massive cytoskeletal rearrangements, a proinflammatory activation by nuclear factor NF-kappa-B, inhibition of early and late events of apoptosis, leading to an increased cell survival, and, at high infection doses, a cytostatic or cytotoxic effect, which interfers with a potent VirB-independent mitogenic activity. These changes of HEC require the T4S coupling protein VirD4 and at least one of the effector proteins BepA-G.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families VirD4/TraG family
Database Links

KEGG: bhe:BH13380

STRING: 283166.BH13380

Related Products

virD4 Proteins

virD4 Proteins for Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.