Recombinant Callithrix jacchus Gonadotropin-releasing hormone II receptor(GNRHR2)

Code CSB-CF850186CYL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q95MG6
Storage Buffer Tris-based buffer,50% glycerol
Species Callithrix jacchus (White-tufted-ear marmoset)
Sequence MSAVNGTPWGSSAREEVWAGSGVEVEGSELPTFSTAAKVRVGVTIVLFVSSAGGNLAVLW SVTRPQPSQLRPSPVRRLFAHLAAADLLVTFVVMPLDATWNITVQWLAGDIACRTLMFLK LMAMYAAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLALPQLFLFHTVHRA GPVPFTQCATKGSFKARWQETTYNLFTFCCLFLLPLTAMAICYSRIVLGVSSPRTRKGSH APAGEFALRRSFDNRPRVRLRALRLALLVLLTFILCWTPYYLLGLWYWFSPSMLSEVPPS LSHILFLFGLLNAPLDPLLYGAFTLGCRRGHQELSMDSSREEGSRRMFQQDIQALRQTEV QKTVTSRKAGETKDIPITSI
Source in vitro E.coli expression system
Gene Names GNRHR2
Protein Names Recommended name: Gonadotropin-releasing hormone II receptor Short name= GnRH II receptor Short name= GnRH-II-R Alternative name(s): Type II GnRH receptor
Expression Region 1-380
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for gonadotropin releasing hormone II (GnRH II). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: cjc:100399755

STRING: 9483.ENSCJAP00000050460

Related Products

GNRHR2 Proteins

GNRHR2 Proteins for Callithrix jacchus (White-tufted-ear marmoset)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.