Recombinant Chicken Ephrin-B1(EFNB1)

Code CSB-CF007465CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O73612
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Gallus gallus (Chicken)
Sequence KSLEPVSWSAGNPKFMSGKGLVIYPEIGDKLDIICPKAEPSKPYDYYKLYLVKKDQADACSTVMDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKRQQDYFITSTSNGTLDGLENREGGVCQTRSMKIVMKVGQDPNAVIPEQLTTSRPSKEADNTVKIVTQSPRHKVPTVEEPGKPGSVNQNGQETQGPSDGFLSSKVAVFAAIGAGCVIFILIIIFLVVLLIKIRKRHRKHTQQRAAALSLSTLASPKCSGNAGSEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Source in vitro E.coli expression system
Gene Names EFNB1
Protein Names Recommended name: Ephrin-B1 Alternative name(s): CEK5 ligand Short name= CEK5-L
Expression Region 26-334
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Ephrin family
Database Links

KEGG: gga:395896

UniGene: Gga.2142

Related Products

EFNB1 Proteins

EFNB1 Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.