Recombinant Chicken PQ-loop repeat-containing protein 2(PQLC2)

Code CSB-CF720004CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5ZJX0
Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Sequence MAEGLRAPPPPGNGSECPDGARWVLRLLGECARDGRDVGSALLGLLSIGCFAAAALPQFY QACKTGIMDRALSIYFLLGWLGGDLLNLIGSFLANQLPLQVYTAVYYVLADLVMLSLYGY YKAKNWGTGATASINAACLFCLLGTATTLTVLSHDTGPAPNPAAFGGRSLLSLGLEGPGP EPISKTEIIGFAIGSISSVLYLCSRLPQIYTNYRRKSTAGVSFLLFALVMLGNLLYGTSV LLKNPEPGQSEGDYILHHLPWLIGSLGVLSLDVIISFQFLAYRTGQPSAGEEREALLAEH GDS
Source in vitro E.coli expression system
Gene Names PQLC2
Protein Names Recommended name: PQ-loop repeat-containing protein 2
Expression Region 1-303
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Amino acid transporter that specifically mediates the pH-dependent export of the cationic amino acids arginine, histidine and lysine from lysosomes.
Subcellular Location Lysosome membrane, Multi-pass membrane protein
Protein Families Laat-1 family
Database Links

KEGG: gga:419472

UniGene: Gga.22371

Related Products

PQLC2 Proteins

PQLC2 Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.