Recombinant Chicken Violet-sensitive opsin

Code CSB-CF341001CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P28684
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Gallus gallus (Chicken)
Sequence MSSDDDFYLFTNGSVPGPWDGPQYHIAPPWAFYLQTAFMGIVFAVGTPLNAVVLWVTVRY KRLRQPLNYILVNISASGFVSCVLSVFVVFVASARGYFVFGKRVCELEAFVGTHGGLVTG WSLAFLAFERYIVICKPFGNFRFSSRHALLVVVATWLIGVGVGLPPFFGWSRYMPEGLQC SCGPDWYTVGTKYRSEYYTWFLFIFCFIVPLSLIIFSYSQLLSALRAVAAQQQESATTQK AEREVSRMVVVMVGSFCLCYVPYAALAMYMVNNRDHGLDLRLVTIPAFFSKSACVYNPII YCFMNKQFRACIMETVCGKPLTDDSDASTSAQRTEVSSVSSSQVGPT
Source in vitro E.coli expression system
Protein Names Recommended name: Violet-sensitive opsin Alternative name(s): Violet cone opsin Violet cone photoreceptor pigment
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity The color pigments are found in the cone photoreceptor cells.
Database Links

KEGG: gga:396419

UniGene: Gga.814

Related Products

Proteins

Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.