Recombinant Chlamydophila abortus Na(+)-translocating NADH-quinone reductase subunit D(nqrD)

Code CSB-CF689440CJA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5L6C2
Storage Buffer Tris-based buffer,50% glycerol
Species Chlamydia abortus (strain DSM 27085 / S26/3) (Chlamydophila abortus)
Sequence MAANKSYKSYFLDPLWNNNQPLIAILGICSALAVTTTVNTALTMGLAVSFVTGCSSFFVS LLRKVTPDSVRMITQLIIISLFVIVIDQFLKAFFFDISKTLSVFVGLIITNCIVMGRAES LARNVPPIPAFLDGFASGLGYGWVLVTVSIIREFFGFGTILGLQLIPKCFYASEAHPDGY ENFGLMVLAPSAFFLLGIMIWGVNILRSKKERR
Source in vitro E.coli expression system
Gene Names nqrD
Protein Names Recommended name: Na(+)-translocating NADH-quinone reductase subunit D Short name= Na(+)-NQR subunit D Short name= Na(+)-translocating NQR subunit D EC= 1.6.5.- Alternative name(s): NQR complex subunit D NQR-1 subunit D
Expression Region 1-213
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families NqrDE/RnfAE family
Database Links

KEGG: cab:CAB353

STRING: 218497.CAB353

Related Products

nqrD Proteins

nqrD Proteins for Chlamydia abortus (strain DSM 27085 / S26/3) (Chlamydophila abortus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.