Recombinant Columba livia Pinopsin

Code CSB-CF342766DVK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P51476
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Columba livia (Rock dove)
Sequence MDPTNSPQEPPHTSTPGPFDGPQWPHQAPRGMYLSVAVLMGIVVISASVVNGLVIVVSIR YKKLRSPLNYILVNLAMADLLVTLCGSSVSFSNNINGFFVFGKRLCELEGFMVSLTGIVG LWSLAILALERYVVVCRPLGDFRFQHRHAVTGCAFTWVWSLLWTTPPLLGWSSYVPEGLR TSCGPNWYTGGSNNNSYILTLFVTCFVMPLSLILFSYANLLMTLRAAAAQQQESDTTQQA ERQVTRMVVAMVMAFLICWLPYTTFALVVATNKDIAIQPALASLPSYFSKTATVYNPIIY VFMNKQFQSCLLKMLCCGHHPRGTGRTAPAAPASPTDGLRNKVTPSHPV
Source in vitro E.coli expression system
Protein Names Recommended name: Pinopsin Alternative name(s): Pineal gland-specific opsin Short name= P-opsin Short name= Pineal opsin
Expression Region 1-349
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produces a slow and prolonged phototransduction response consistent with the non-visual function of pineal photoreception.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Pineal gland.

Related Products

Proteins

Proteins for Columba livia (Rock dove)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.