Recombinant Cronobacter sakazakii UPF0266 membrane protein ESA_01432 (ESA_01432)

Code CSB-CF418413CXL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7MKF9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Sequence MTLTDGVLVIFIIALLGWAIYDQWGTERRHGKTLLRVPLLKRGRADSLIFTGLVAILIWQ NVASHGALLTTWLLGALGLLAIYLFWIREPQIRFKREGFFFAGGWVKYNHIKAMNLSEDG VLVMQLDKRRLLIRVKNIDDLERIYHFIVNNQ
Source in vitro E.coli expression system
Gene Names ESA_01432
Protein Names Recommended name: UPF0266 membrane protein ESA_01432
Expression Region 1-152
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0266 family
Database Links

KEGG: esa:ESA_01432

STRING: 290339.ESA_01432

Related Products

ESA_01432 Proteins

ESA_01432 Proteins for Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.