Recombinant Cytochrome b559 subunit alpha(psbE)

Code CSB-CF628634SDI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q1KVR5
Storage Buffer Tris-based buffer,50% glycerol
Species Tetradesmus obliquus (Green alga) (Acutodesmus obliquus)
Sequence MAGKPVERPFSDILTSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGSPRPNEYFTEDR QDAPLVTDRFNALEQVKKLSQ
Source in vitro E.coli expression system
Gene Names psbE
Protein Names Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit V
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water
Subcellular Location Plastid, chloroplast thylakoid membrane, Single-pass membrane protein
Protein Families PsbE/PsbF family

Related Products

psbE Proteins

psbE Proteins for Tetradesmus obliquus (Green alga) (Acutodesmus obliquus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.