Recombinant Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein B(fscB)

Code CSB-CF684689DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q54RQ3
Storage Buffer Tris-based buffer,50% glycerol
Species Dictyostelium discoideum (Slime mold)
Sequence QKLPDGFCPSPLIYKNSTDRISDINRGYQFIGETNCVQPCPSLVYSESDWKNFFDASLYG GAISIFCSLFLLITYSPLVNNKHNRHTISIMFLFSGIFIMLASNGRVFWNNNEGYFDRIC PEKGRFARQSDRYCLAMGIFYQFGCLTGMMWWTTLSVDVWMTIKKIKISNRQIFYYACIV NFLAIFLTFIPIARDQYGASNFGIGCWILGLWDQVFGFWAPLGICLTIGCIFITLIMYEI YKATGQIKKKLLLKYYKPLVLIILMFFEFFYMFIFITYIIDHRNKYNDEVAEYIVCILIN SGNPNYDEICKIKRSIPPAAQFLFFLFSRLMGFEGVIFYGLTNQTKRIWLRSFWFNNRIS LKFRSSFNISSSTNSSTNTFEKQTPSHLVDPIDQFDNIEISNNQNIELSQIENK
Source in vitro E.coli expression system
Gene Names fscB
Protein Names Recommended name: Frizzled/smoothened-like sans CRD protein B
Expression Region 23-436
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor Fz/Smo family
Database Links

KEGG: ddi:DDB_G0282989

Related Products

fscB Proteins

fscB Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.