Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein E(grlE)

Code CSB-CF706697DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q54ET0
Storage Buffer Tris-based buffer,50% glycerol
Species Dictyostelium discoideum (Slime mold)
Sequence EVVKPNPAKPDELVIAFMSPYFDPEYTQYSGAAEYALSKFNETFKTKYSKTIKLHTFTDT NDVIDSLDLVTMPVNGIVGPAYSGSSSTACLVFGAFAVPSISFYATGASLSNSGSYPYFQ RVMPDDRLQVQAILSLLKKNGWTRVSCIHTNEDYGNGGADQLVQQSNAQGITVNTNQAID PVDNGIAPEQLYYDIVFDNLEAAKSRVIVLYALFPPDCLEIWKQAKARGFLGEGFTWIVT DGCAELTGGTDPDLLGVLATFPSYGLGTEAYTDFERTIVNDYNNNTGDAFYKGASFSYDA TYAMLMGIEAVLAKGGDPWDGEQVRTELRNLKFNGITGTIAFDKNTGDRLYGEFALLNLI NSTKGSFDPIGKINPDSGEITLKSDILYSGPTYKVPSDYQVVVFDRTLNIVLGVITGVCV LIVIGIGSVIALQWRKFRYSSPLFCMFIIIGALMGLASVFTLLPTPTTPLCSGFPWLLGL GYVIVFGTLFTKTWRTWRLFSNARKFKIIRITNKFIITLVGGFVLLESIFMIIWTAVDRP IPLAEPIFKAGEAQLQCTSDSEAWWYVFVFYKVFYILFGVFLAFKTRNVVDSLNESKPIT LALYNLTFVMVVAIALGFILRDNPIAIIVIQTIAILLGFTVTVSVLFLPKVWMILSGQQH SMDSIGTSMDSMGRSNGNTTEAESTRGYTNKDYNNQSVGRSFSAHATGFKDVAPSNHPQL GIVYTGGDNFPRVGSSQTAASRSEAEINVSKDVLAKANKKNEEEFGEFFLKPSEDNILKK KKKKKNNNK
Source in vitro E.coli expression system
Gene Names grlE
Protein Names Recommended name: Metabotropic glutamate receptor-like protein E Alternative name(s): DdmGluPR GABA-B receptor-like protein grlE
Expression Region 28-816
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in early development in cAMP sensing and subsequent chemotactic response. Probable receptor of GABA and glutamate, leading respectively to the induction or inhibition of SDF-2 formation.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 3 family
Database Links

KEGG: ddi:DDB_G0291356

STRING: 44689.DDB0231976

Related Products

grlE Proteins

grlE Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.