Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein J(grlJ)

Code CSB-CF745053DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q75JT4
Storage Buffer Tris-based buffer,50% glycerol
Species Dictyostelium discoideum (Slime mold)
Sequence SECKIAVLLSGSPNDLGYNYLMNEARVKAESELKLDFSIYYENLEESMEEAEKAFQDALH KGANLIVVGSFVHVGLGLKYAALTKDQDIYWIIRGNKRPNPDLPHVVILNFNSFELHYLL GYFSGLMTKTGIVGFVAPGPDVNTISTDNSFYLGAKYARPNITFLNVYVQSWYNPNVSYS AAKMLIKNGADLIGMSQDDMSCQKAMMDSGLIGIGATGYPTHLLFGGNVGVSYITNWTNL YVKYAQHVLNDDWPDYSSYFTNLSREDSIFIDDYSYKVPIDIQNLVNDEIQRLKNTSYIP YRSDPYLAQLGIPFDSKGLLVEDQFRANKKLLKGDSISKVIDFGQYSIPIEFIDYPNSLK YGVTIVSGVCIFICLVCMTLVVVFKKARVIKSSSPAFLLLILLGCCIIFAACILFAQSPT NQTCSARIWLLSLGYTLFLGNLLVKNWRIWLLFDNPKLKKRAITNWKLYPWVFAILAIDV MILAIWQGLGNINAESRIGYDSLTQYQYKNVCSSDDQGSIALYLLLVFHGLVLLVACFIS FKIKVVDIEEFNESKPITTSVYIITFCLFIVIPLMVSPQSLTSQTTIICVCAIVTTLISM LLLFGSKFYKMATQGLAINETFATSTKSSSKSSKSSYGKDNPNPNAINFGEDDTSDETSE EKHKSPKQKSVNFSNKSNSHLAVFTSDEETSKTSKLSIDFENSSKDISIDQLQQQKQQPI NTNGDLENKSNDKIDDDNDNSSVLSKRISNQQNGETEIDSNNV
Source in vitro E.coli expression system
Gene Names grlJ
Protein Names Recommended name: Metabotropic glutamate receptor-like protein J
Expression Region 21-783
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May act during the development and be a negative regulator.
Subcellular Location Cell membrane, Membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Golgi apparatus membrane, Nucleus envelope
Protein Families BMP lipoprotein family; G-protein coupled receptor 3 family, GABA-B receptor subfamily
Database Links

KEGG: ddi:DDB_G0272150

STRING: 44689.DDB0231983

Related Products

grlJ Proteins

grlJ Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.