Recombinant Dictyostelium discoideum Sugar transporter SWEET1(slc50a1)

Code CSB-CF687618DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q54JW5
Storage Buffer Tris-based buffer,50% glycerol
Species Dictyostelium discoideum (Slime mold)
Sequence MEDEKNENLMTFIQFCATFITITLFIMPLKTIRLIIEKKNVGTVAGLQFISSVLNCFLWI SYALLTSNTTMLFVNSIGMMFSIYYVFNYWKNINQVRASRDYLKKVMIACVLAITIISIS YYNTVDDLDTRISRLGFLSSVVCVLMFASPLEKMAIVIQSKNSEGMIINVAILSLLCGLS WTIFGLLLNDIYIYLPNILASILSFVQLTLIKLYPPQILL
Source in vitro E.coli expression system
Gene Names slc50a1
Protein Names Recommended name: Sugar transporter SWEET1
Expression Region 1-220
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates both low-affinity uptake and efflux of sugar across the membrane.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families SWEET sugar transporter family
Database Links

KEGG: ddi:DDB_G0287763

STRING: 44689.DDB0187619

Related Products

slc50a1 Proteins

slc50a1 Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.