Recombinant Geobacillus kaustophilus UPF0754 membrane protein GK0639(GK0639)

Code CSB-CF683427GAAA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5L2A6
Storage Buffer Tris-based buffer,50% glycerol
Species Geobacillus kaustophilus (strain HTA426)
Sequence METFVYLLFMVAVGALIGGVTNFIAIVMLFRPYEPMYVFGKRLPFTPGLIPKRRRELAEQ LGKTVVEHLVTPEGLRRKLMDPSFTAEMAEWGREWLRKWLARKETPAELLERLGIRSPAE RLEAMAAEQAERAYERWSETWRLRPIRDVLPAELKQTMEARVESLAGYLADRTLDYFRSE EGKQQISSMIERFFQERGMVGNMLQMLLGNVNFVDKVQAELGKFLRHAGTREVLSRLLWT EWNKWLDYPLATVEEMIGRRRIDEAVRSAARRLVQSGSWLHRPLDELIAPYEQPLFDRLI PQAAATVSCLLSDKIEAIVAQLGLADIVRDQVESFSLRRLEAIILSIARRELKMITYLGA LLGGLIGAVQGVIGLWL
Source in vitro E.coli expression system
Gene Names GK0639
Protein Names Recommended name: UPF0754 membrane protein GK0639
Expression Region 1-377
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0754 family
Database Links

KEGG: gka:GK0639

STRING: 235909.GK0639

Related Products

GK0639 Proteins

GK0639 Proteins for Geobacillus kaustophilus (strain HTA426)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.