Recombinant Heliothis virescens Octopamine receptor

Code CSB-CF632855HVF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q25188
Storage Buffer Tris-based buffer,50% glycerol
Species Heliothis virescens (Tobacco budworm moth)
Sequence MGQAATHVDANYTLINYTEEVIEDDRDACAVADDPKYPSSFGITLAVPEWEAICTAIVLT LIIISTIVGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQWVF GIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLLMIGVVWVLS LIISSPPLLGWNDWPDVFEPDTPCRLTSQPGFVIFSSSGSFYIPLVIMTVVYFEIYLATK KRLRDRAKATKISTISSGQNKYNNKDDHHDQDSVSSEANHNEHQGVTRLVSDNEKKKRTR KLTPKKKPKRKYWSKDDKSQNKLIIPILSNENSVTDMGENLENRNTSSESNSKETHEDDL IEVNETVPVKTHHKKPKPNQQSAVYQFIEEKQRISLTRERRAARTLGIIMGVFVVCWLPF FVIYLVIPFCASCCLSNKFINFITWLGYCNSALNPLIYTIFNMDFRRAFKKLLCMKP
Source in vitro E.coli expression system
Protein Names Recommended name: Octopamine receptor
Expression Region 1-477
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for octopamine. Octopamine (OA) is a neurotransmitter, neurohormone, and neuromodulator in invertebrates. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family

Related Products

Proteins

Proteins for Heliothis virescens (Tobacco budworm moth)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.