Recombinant Heterocapsa triquetra Cytochrome b6(petB)

Code CSB-CF895004HCAB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9XQU7
Storage Buffer Tris-based buffer,50% glycerol
Species Heterocapsa triquetra (Dinoflagellate) (Glenodinium triquetrum)
Sequence MGFIYDWSEERLEIQSIADDILSKFVPSHVNIFYCFGGIVLTAFIFQGASGFALTIYYRP TVVEAFSSIQLILYHVNLGWFIRSIHRWSSGCMVLVLILHISRVYLTGGFKKPRELTWIS GVILAVVTVSFGVTGYSLPWDQIGYWACKIVTAVPEALDDLLPGAGKLLVLTLRGGFSVG QTTLTRLYSIHTFVLPLVTLVLLIVHFSLLRKQGISGPL
Source in vitro E.coli expression system
Gene Names petB
Protein Names Recommended name: Cytochrome b6
Expression Region 1-219
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Subcellular Location Plastid, chloroplast thylakoid membrane, Multi-pass membrane protein
Protein Families Cytochrome b family, PetB subfamily

Related Products

petB Proteins

petB Proteins for Heterocapsa triquetra (Dinoflagellate) (Glenodinium triquetrum)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.