Recombinant Human 7-dehydrocholesterol reductase (DHCR7)

Code CSB-CF006844HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
DHCR7
Uniprot No.
Alternative Names
DHCR7; D7SR; 7-dehydrocholesterol reductase; 7-DHC reductase; Delta7-sterol reductase; Sterol Delta(7-reductase; Sterol reductase SR-2
Species
Homo sapiens (Human)
Expression Region
1-475
Target Protein Sequence
MAAKSQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA CDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLYTLWVTFQVLLYTSLPDFCHK FLPGYVGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIFDNWIPL LWCANILGYAVSTFAMVKGYFFPTSARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFN GRPGIVAWTLINLSFAAKQRELHSHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYIFRVANHQKDL FRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMGSLAYCL ACGGGHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
7-dehydrocholesterol reductase of the cholesterol biosynthetic pathway reducing the C7-C8 double bond of cholesta-5,7-dien-3beta-ol (7-dehydrocholesterol/7-DHC) and cholesta-5,7,24-trien-3beta-ol, two intermediates in that pathway.
Gene References into Functions
  1. aim of this study was to determine the association between single nucleotide polymorphisms (SNPs) of PNPLA3 (rs738409), COX-2 (rs689465) and DHCR7 (rs12785878) and advanced liver fibrosis in Thai patients PMID: 30139224
  2. pathogenic mutations in DHCR7 protein are located either within the transmembrane region or are near the ligand-binding site, and are highly conserved among species. PMID: 29300326
  3. The DHCR7 polymorphism may be a pre-treatment predictive marker for response to PEG-IFN-based therapy in chronic HCV genotype 1 infection. PMID: 28415985
  4. phosphorylation modulates DHCR7 activity in cells, and contributes to the overall synthesis of cholesterol, and probably vitamin D PMID: 27520299
  5. Allelic variations in CYP2R1 and GC affect vitamin D levels, but variant alleles on VDR and DHCR7 were not correlated with vitamin D deficiency. PMID: 26038244
  6. Review: DHCR7 activity should be considered during drug development and prenatal toxicity assessment. PMID: 27401223
  7. In this study, we demonstrate that the prevalent c.964-1G>C Dhcr7 mutation perturbs SMO cilia localization and SHH pathway activation as a consequence of reduced cholesterol biosynthesis PMID: 26685159
  8. these findings highlight DHCR7 as an important regulatory switch between cholesterol and vitamin D synthesis. PMID: 26887953
  9. The aim of this study was to investigate the association of three polymorphisms in the GC gene (rs7041 and rs4588) and CYP2R1 gene (rs10741657) on 25-(OH) VD serum concentration among Jordanians. PMID: 26383826
  10. This study shows that Smith-Lemli-Opitz Syndrome patients who are heterozygous/homozygous for one pathogenic mutation and only one parent carrying that mutation are candidates for DHCR7 gene (partial) deletions. PMID: 25040602
  11. Polymorphisms in CYP2R1-rs10766197 and DHCR7/NADSYN1-rs12785878 are associated with vitamin D deficiency in Uygur and Kazak ethnic populations PMID: 26149120
  12. physical and functional interaction between DHCR24 and DHCR7 PMID: 25637936
  13. In this mendelian randomisation study, we generated an allele score (25[OH]D synthesis score) based on variants of genes that affect 25(OH)D synthesis or substrate availability (CYP2R1 and DHCR7) PMID: 24974252
  14. rs3829251 (DHCR7) influenced progression of subclinical atherosclerosis in a manner dependent on type 2 diabetes status but independent of 25(OH)D levels. The SNP modulates DHCR7 mRNA levels in aortic adventitia. PMID: 24663808
  15. NADSYN1/DHCR7 locus (rs12785878 and rs1790349) polymorphisms have an effect on plasma 25-hydroxyvitamin D levels and coronary artery disease incidence PMID: 24642724
  16. This study provides evidence that the DHCR7 gene is involved in the susceptibility to ocular Behcet disease. PMID: 24184224
  17. Data indicate that SNPs in the DHCR7/NADSYN1 locus showed evidence of positive association with rheumatoid arthritis (RA). PMID: 23636220
  18. Data indicate that the same nucleotide polymorphisms (SNPs) genotypes of CYP2R1, GC and DHCR7 that are associated with reduced 25(OH)D3 serum levels were found to be associated with hepatitis C virus (HCV)-related hepatocellular carcinoma (HCC). PMID: 23734184
  19. In patients with genotype 1 chronic hepatitis C, GG homozygosis for DHCR7 gene and lower 25-hydroxyvitamin D levels are independently associated with the severity of liver fibrosis. PMID: 23730842
  20. Studies suggest DHCR7 mutation for the diagnosis of Smith-Lemli-Opitz Syndrome. PMID: 23321614
  21. Genetic variation in DHCR7 associated with lower serum 25(OH)D has a decreased risk of aggressive prostate cancer. PMID: 23377224
  22. The p.Thr93Met is the most frequent mutation in Turkish SLOS patients showing that there might be a founder in East Mediterranean regions PMID: 22211794
  23. Our study is the first to confirm the association of variants in DHCR7 and CYP2R1 with 25(OH)-vitamin D levels in patients with chronic liver diseases. Results also showed an association between DHCR7 and liver stiffness. PMID: 22576297
  24. we found that the two variant genotypes of DHCR7/NADSYN1 (rs3829251, rs12785878) were both associated with serum 25-hydroxyvitamin D levels. PMID: 22801813
  25. Two previously reported N287K (861 C>A) and R352Q (1055 G>A) and a novel R352L (1055 G>T) mutations were identified in the DHCR7 gene in these patients. PMID: 21696385
  26. ANKRD55 and DHCR7 are novel multiple sclerosis risk loci. PMID: 22130326
  27. several SNPs related to calcium metabolism are associated with height, in particular rs3829251 at the DHCR7/NADSYN1 gene. PMID: 22390397
  28. This study demonistrated that the accumulation of an immediate cholesterol precursor, 7-DHC and its oxysterol metabolite, 3beta,5alpha-dihydroxycholest-7-en-6-one (DHCEO)in DHCR7 knockout mice. PMID: 22182693
  29. GC and NADSYN1/DHCR7 loci individually and collectively contribute to variation in plasma vitamin D levels in Chinese Hans. PMID: 21972121
  30. Study confirms that variation in DHCR7 is associated with predisposition to autoimmune disease type 1 diabetes. PMID: 21441443
  31. Mutations of the 7-dehydrocholesterol reductase gene is associated with Smith-Lemli-Opitz syndrome. PMID: 20635399
  32. LBR mutant variants and sterol reductases can severely interfere with the regular organization of the nuclear envelope and the endoplasmic reticulum. PMID: 19940018
  33. The p.G366V is a novel mutation of the DHCR7 gene with guanine by thymine nucleotide exchange resulting in glycin by valin amino acid exchange in the dehydrocholesterol reductase enzyme. PMID: 19365639
  34. This protein catalyses the last step of endogenous cholesterol synthesis. SLOS is caused by a biochemical enzymatic defect. PMID: 11767235
  35. identified a new mutation in DHCR7 PMID: 11857552
  36. Mutation analysis demonstrated a novel mutation in the DHCR7 gene, present in homozygous form in the two affected individuals available for testing, and heterozygous in the parents. PMID: 12116246
  37. SLOS is a recessive gene disorder. A fetus was found to have renal agenesis. PMID: 12833423
  38. Our identification of a single haplotype associated with the T93M mutation in patients whose ancestors originate in the region of the Mediterranean Sea basin suggests a founder effect. PMID: 14981719
  39. DHCR7 mutations have a role in the Smith-Lemli-Opitz syndrome PMID: 15776424
  40. identification of nine novel missense mutations of the DHCR7 gene PMID: 15954111
  41. Mutational analysis of the DHCR7 gene led to the identification of seven distinct mutations, three of which are new (F174S, H301R, and Q98X) for Smith-Lemli-Opitz syndrome. PMID: 15979035
  42. In Polish individuals with SLOS two DHCR7 mutations, c.452G>A (p.Trp151X) and c.976G>T (p.Val326Leu), account for 65.2% of all observed DHCR7 mutations. PMID: 16497572
  43. DHCR7 mutation is a rapid and reliable method for prenatal diagnosis of Smith-Lemli-Opitz syndrome. PMID: 17441222
  44. DHCR7 gene mutations is associated with Smith-Lemli-Opitz syndrome. PMID: 17595012
  45. it appears that a combination of founder effects, recurrent mutations, and drift have shaped the present frequency distribution of DHCR7 mutations in Europe PMID: 17965227
  46. The study identified compound heterozygous mutations ([p.Arg352Trp] + [p.Lys376ArgfsX37]) in a Korean girl with clinical and laboratory features typical of Smith-Lemli-Opitz syndrome. PMID: 18006960
  47. DHCR7 mutation is associated with Smith-Lemli-Opitz syndrome PMID: 18249054
  48. study determined the mutational spectrum of DHCR7 gene in 17 Slovak Smith-Lemli-Opitz syndrome patients; 6 different mutations were identified: nonsense mutation W151X and missense mutations V326L, L109P, G410S, R352Q, Y432C PMID: 19390132

Show More

Hide All

Involvement in disease
Smith-Lemli-Opitz syndrome (SLOS)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
ERG4/ERG24 family
Tissue Specificity
Widely expressed. Most abundant in adrenal gland, liver, testis, and brain.
Database Links

HGNC: 2860

OMIM: 270400

KEGG: hsa:1717

STRING: 9606.ENSP00000347717

UniGene: Hs.503134

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X