Recombinant Human Gap junction alpha-4 protein (GJA4)

Code CSB-CF009447HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GJA4
Uniprot No.
Alternative Names
GJA4; Gap junction alpha-4 protein; Connexin-37; Cx37
Species
Homo sapiens (Human)
Expression Region
2-333
Target Protein Sequence
GDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGC TNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDP QVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTM EPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMR ARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLA SSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
  1. Data show that fluid shear stress activates NOTCH signaling, which upregulates GJA4 (commonly, Cx37) and downstream cell cycle inhibitor CDKN1B (p27). PMID: 29247167
  2. CONNEXIN-37 gene polymorphisms are an ischemic stroke risk factor in Northern Han Chinese. PMID: 29631604
  3. ur study describes for the first time an association of drug-resistant non-structural heart disease AF with the Cx37 1019C > T gene polymorphism. We also confirmed the association of the Cx40 - 26G > A polymorphism in patients with AF and structural disease. PMID: 29351227
  4. the present study reported on a Cx37 variant in two Caucasian primary ovarian insufficiency (POI)patients, which was absent in control Caucasian populations, and which had a deleterious effect in vitro. It is therefore suggested that in the genetic context of the Caucasian population, this variant may contribute to POI. PMID: 29207017
  5. This study shows that Cx37 C1019T and Cx40 A71G polymorphisms are not associated with cardioprotective role in Egyptians. PMID: 28969560
  6. The CX37 rs1764390 G allele is associated with increased susceptibility to sepsis, which may be involved in the process of sepsis via mediating the plasma levels of NO, IL-6 and CRP. PMID: 27939333
  7. The C allele in the CX37 gene might be associated with susceptibility to dilated cardiomyopathy (DCM) in Chinese Han; female carriers of the C allele had higher DCM risk compared with TT homozygotes than males PMID: 25501978
  8. The protective effect of the T allele of the Cx37 gene might be strongly modified by smoking; in women, this effect could be mediated through stem cells. PMID: 26588185
  9. Our findings suggest that the Cx37 C1019T variation may contribute to the risk of PCOS in the South Indian women. PMID: 26656196
  10. Review/Meta-analysis: Cx37 C1019T was a risk factor for myocardial infarction and a protective factor for coronary artery disease. PMID: 24937033
  11. The C allele in the CX37 gene might be associated with the susceptibility to EH in population of Wuxi, China. PMID: 24685073
  12. three variants in PNPLA3 gene may be a genetic risk factor for NASH PMID: 24773516
  13. the C1019T polymorphism may be a moderate risk factor for MI and that DM was likely a potential source of between-study heterogeneity. [META-ANALYSIS] PMID: 24333099
  14. Determination of Cx37 C1019T and eNOS G894T polymorphisms may be used to detect a genetic predisposition to the development of myocardial infarction in patients with hemodynamically insignificant atherosclerosis and in apparently healthy individuals. PMID: 24261225
  15. 1019C/T polymorphism in the CX37 gene is associated with susceptibility to coronary artery disease as well as restenosis after coronary stenting in male patients. PMID: 23926016
  16. It is suggested that the polymorphism in the Cx37 gene (but not Cx40 gene) potentially plays a significant role in the manifestation of AMI disease in Iranian population PMID: 23724624
  17. C1019T polymorphism in the connexin 37 gene is associated with Helicobacter pylori infection and gastric cancer. PMID: 22901223
  18. We report the presence of connexins in platelets, notably connexin37, and that the formation of gap junctions within platelet thrombi is required for the control of clot retraction. PMID: 22528526
  19. GJA4 polymorphism is not associated with stroke risk in the Taiwanese population. PMID: 22305353
  20. We propose that the establishment of gap junctional communication between Cx37-expressing platelets provides a mechanism to limit thrombus propensity. PMID: 21810657
  21. In women with higher fasting glycemia TT genotype of Cx37 polymorphism was protective against subclinical atherosclerosis. PMID: 21617605
  22. The gene for Cx37 was associated with subclinical atherosclerosis in women with type 1 and 2 diabetes and in women with advanced central obesity. PMID: 21208019
  23. Connexin 37 genetic variants significantly affect carotid IMT and contribute to future development of ischemic stroke PMID: 21044781
  24. Endothelium-dependent vasodilation is primarily mediated by connexin 37 in mesenteric artery. PMID: 21172909
  25. Cx37 C1019T polymorphism is associated with tumour cell proliferation. PMID: 20705954
  26. Data show for the first time a functional and specific interaction between eNOS and Cx37 in endothelial cells. PMID: 20081116
  27. These data suggest that alterations of specific connexins, in this case connexin 37, and resulting changes in intercellular communication may modulate endothelial cell growth and death. PMID: 15194487
  28. NO inhibits the intercellular transfer of small molecules by a specific influence on Cx37 PMID: 15481066
  29. Here, data for human connexin37 (hCx37) hemichannels indicate that voltage gating can be explained as block/unblock without the necessity for an independent voltage gate. PMID: 15504903
  30. T1019 Cx37 SNP has shown to be a risk factor for acute myocardial infarction (AMI). PMID: 15982495
  31. investigated whether the allelic variants 1019C and 1019T are differentially predictive of increased risk for coronary artery disease (CAD) and myocardial infarction (MI) PMID: 16677656
  32. The connexin37 C1019T polymorphism is not related with markers of subclinical atherosclerosis in young adults in Finland PMID: 17196598
  33. Cx37 is expressed in the vascular endothelium as well as in monocytes and macrophages and these three cell types are key players in atherogenesis. PMID: 17318613
  34. Connexin 37 is expressed in the granulosa layer of follicles in the human ovary, and expression of Cx37 in granulosa cells was not different between poor responder and nonpoor responder to ovulation induction. PMID: 17531234
  35. Study suggests that GJA4 gene C1019T polymorphism and/or its related C-C-D haplotype might contribute to an increased risk of CAD and potentially play an important role in the development of coronary atherosclerosis in northern Han Chinese. PMID: 18073482
  36. variation in the connexin gene may modify effects risk factors have on vascular function PMID: 18605953
  37. As much as half the length of the connexin N-terminus can be deleted without affecting formation of gap junction plaques, but an intact N-terminus is required for hemichannel gating and intercellular communication. PMID: 18664489
  38. The electrical properties of Cx37 hemichannels (HCs) and gap junction channels (GJCs) were measured with voltage-clamp methods. PMID: 19166859
  39. connexin37 C1019T polymorphism is associated with peripheral artery disease in Japanese type 2 diabetic patients. PMID: 19407064
  40. The alpha helical structure of the connexin 37 N terminus may be dispensable for protein localization, but it is required for channel and hemichannel function. PMID: 19478091

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Tissue Specificity
Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium.
Database Links

HGNC: 4278

OMIM: 121012

KEGG: hsa:2701

STRING: 9606.ENSP00000343676

UniGene: Hs.296310

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1