Recombinant Human Progestin and adipoQ receptor family member 6(PAQR6)

Code CSB-CF754370HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6TCH4
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MLSLKLPQLLQVHQVPRVFWEDGIMSGYRRPTSSALDCVLSSFQMTNETVNIWTHFLPTW YFLWRLLALAGGPGFRAEPYHWPLLVFLLPACLYPFASCCAHTFSSMSPRMRHICYFLDY GALSLYSLGCAFPYAAYSMPASWLHGHLHQFFVPAAALNSFLCTGLSCYSRFLELESPGL SKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHLFCALLTGFLFASH LPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLATQEPALGLAGTVA TLVLAAAGNLLIIAAFTATLLRAPSTCPLLQGGPLEGGTQAKQQ
Source in vitro E.coli expression system
Gene Names PAQR6
Protein Names Recommended name: Progestin and adipoQ receptor family member 6 Alternative name(s): Progestin and adipoQ receptor family member VI
Expression Region 1-344
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plasma membrane progesterone (P4) receptor coupled to G proteins
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Tissue Specificity Brain specific (PubMed:16044242, PubMed:23763432). Highly expressed in the hypothalamus, also expressed in forebrain, amygdala, corpus callosum and spinal cord (PubMed:23161870).
Database Links

HGNC: 30132

OMIM: 614579

KEGG: hsa:79957

STRING: 9606.ENSP00000338330

UniGene: Hs.235873

Related Products

PAQR6 Proteins

PAQR6 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.