Recombinant Hydrogenobaculum sp. Potassium-transporting ATPase B chain(kdpB)

Code CSB-CF480340HXT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B4U8E4
Storage Buffer Tris-based buffer,50% glycerol
Species Hydrogenobaculum sp. (strain Y04AAS1)
Sequence MKKKELSIFDKDILKEASINSIKKLNPVELLRNPVMLSVEIGSTITTFDFFYDLATNNNH AWFSANVSLWLWLTVLFSNFAESIAESRGKARAKSLREAKSNLFAKKLKNKNDKTYEKIP ASSLQKGDLFLLEKDDIIPIDGELIEGVLLVNESAVTGESAPVIRESGTDKSSVTAGTKV VSGSAVAVASVNPGETFIDKMISLVEGAKRRKTPNEIALEILIISLTIVFLVVVINFRAL SYYSVYSTNKGSVVSLVVLVALFVCLAPTTIAALLPAIGIAGMDRLFKKNIIALSGRAIE AAGDANVLFLDKTGTITYGDRQAYKLIPVEGVSEEELAMVAHMASIGDTTAEGKSIYAFT KAKYNLSIDLKDYKVIEFDASTRISGVDTKNEHYRKGSSDAIEKYVSSFGGSIPKNLDKI VEEVAKEGGTPLVVAKDNRIYGVVYLKDIIKPGIKKKFRELRRAGIKTVMITGDNPLTAA TIAAEAGVDDFLAQAKPEDKLRHIKKYQEEGYMVAMTGDGTNDAPALAQADVAVAMNSGT QAAKDAANIIDLDNDPSKLIEVVGIGKEILITRGAITTFSIANDISKYFVIVPAAVSKSY PELNILNILHLANPYIAILSAVIFNAIVIPMLIPLALKGVKYRPMDAQTLLVRNLSIYGI GGILFPFFGIWIVYWICEIFWRVL
Source in vitro E.coli expression system
Gene Names kdpB
Protein Names Recommended name: Potassium-transporting ATPase B chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] B chain Potassium-binding and translocating subunit B Potassium-translocating ATPase B chain
Expression Region 1-684
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit is responsible for energy coupling to the transport system.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Cation transport ATPase (P-type) (TC 3.A.3) family, Type IA subfamily
Database Links

KEGG: hya:HY04AAS1_0718

STRING: 380749.HY04AAS1_0718

Related Products

kdpB Proteins

kdpB Proteins for Hydrogenobaculum sp. (strain Y04AAS1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.