Recombinant Hypersensitivity response secretion protein hrpI(hrpI)

Code CSB-CF330467PWD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P35655
Storage Buffer Tris-based buffer,50% glycerol
Species Pseudomonas syringae pv. syringae
Sequence MNRVINFLNMVALSAMRRSELVGAFFVIAIVFMMITPLPTGLIDVLIAVNICISCLLIML AMHLPRPLAFSTFPAVLLLTTMFRLALSVSTTRLILLNQDAGHIVEAFGQFVVGGNLAVG LVIFLILTVVNFLVITKGSERVAEVGARFTLDAMPGKQMSIDSDLRANLITVHEARKRRA ELNKESQLFGAMDGAMKFVNGDAIASLIIVAINMIGGISIGVLQHNMAAGDALQLYTVLT IGDGLIAQIPALLISVTSGMIITRVPNTEAGVEANIGREIAEQITSQPKAWIIASVAMLG FAALPGMPTGVFITIAIICGAGGLLQLQRAKPKADEQRTAAVAPEMNGKEDLRTFSPSRQ FVLQFHPGQDSAQIEALVSEIRKRRNRLVVQYGLTLPSFIIEHVDDIAPDEFRFTVYDVP MLKATFTQSHVAVEARQLEGENLPAAIPGNTDRQEDQWVWLPAEQSGELNPVSSTTLIIE RMERALQSCAPQFIGLQETKAILSWLESEQPELAQEMQRVLTLTRFSAVLQRLASECVPL RAIRVIAETLIEHCQHERDTNVLTDYVRIALKSQIYHQYCGAEGLQVWLVTPESEGLLRD GLRQTQTETFFALSNETSQMLVQQLHIAFPVRAPEQAVLLVAQDLRSPLRTLLREEFYHV PVLSFAEISNAAKVKVMGRFDLEDDLEPLDNEHAA
Source in vitro E.coli expression system
Gene Names hrpI
Protein Names Recommended name: Hypersensitivity response secretion protein hrpI
Expression Region 1-695
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the secretion of harpin-pss; a proteinaceous elicitor of the hypersensitivity response in plants.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families FHIPEP (flagella/HR/invasion proteins export pore) family

Related Products

hrpI Proteins

hrpI Proteins for Pseudomonas syringae pv. syringae

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.