Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF721744KBK |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q6CXZ7 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) |
| Sequence | MSHFKIVFLTSLSLALVFELFNTISVPITSHLFISEYNGYKFGVFGWCKVDGSICSPIRM GYSLDDILLFNDNEYLHLPNHAKYALSKLLLVHVLSFVCVLVFWLFAILICIKWLNTSKS VLLFAVGWSMVTFMVSLLGFLIDVLMFASHVTWSSWLMLVSAFFVALSGILLCLMIRDLS YRRFVKLQGEVDVCVPMTEPRDPDELNEIWKKKTSKREIL |
| Source | in vitro E.coli expression system |
| Gene Names | KLLA0A04389g |
| Protein Names | Recommended name: pH-response regulator palI/RIM9 homolog 1 |
| Expression Region | 1-220 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | PalI/RIM9 family |
| Database Links |
KEGG: kla:KLLA0A04389g STRING: 284590.XP_451192.1 |
KLLA0A04389g Proteins for Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP721744KBK1 CSB-EP721744KBK1 CSB-BP721744KBK1 CSB-MP721744KBK1 |
Recombinant Kluyveromyces lactis pH-response regulator palI/RIM9 homolog 1(KLLA0A04389g),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Bovine Pulmonary surfactant-associated protein C(SFTPC)
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Human Mothers against decapentaplegic homolog 3(SMAD3)
Express system: Baculovirus
Species: Homo sapiens (Human)
Recombinant Human G2/mitotic-specific cyclin-B1(CCNB1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Glycogen synthase kinase-3 beta(GSK3B)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Neurofilament light polypeptide(NEFL)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Very long-chain acyl-CoA synthetase(SLC27A2),partial
Express system: E.coli
Species: Homo sapiens (Human)
